KEGG   Tupaia chinensis (Chinese tree shrew): 102495542Help
Entry
102495542         CDS       T02978                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00010  Glycolysis / Gluconeogenesis
tup00053  Ascorbate and aldarate metabolism
tup00071  Fatty acid degradation
tup00260  Glycine, serine and threonine metabolism
tup00280  Valine, leucine and isoleucine degradation
tup00310  Lysine degradation
tup00330  Arginine and proline metabolism
tup00340  Histidine metabolism
tup00380  Tryptophan metabolism
tup00410  beta-Alanine metabolism
tup00561  Glycerolipid metabolism
tup00620  Pyruvate metabolism
tup01100  Metabolic pathways
Module
tup_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tup_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102495542 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    102495542 (ALDH7A1)
   00620 Pyruvate metabolism
    102495542 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102495542 (ALDH7A1)
   00561 Glycerolipid metabolism
    102495542 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102495542 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    102495542 (ALDH7A1)
   00310 Lysine degradation
    102495542 (ALDH7A1)
   00330 Arginine and proline metabolism
    102495542 (ALDH7A1)
   00340 Histidine metabolism
    102495542 (ALDH7A1)
   00380 Tryptophan metabolism
    102495542 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102495542 (ALDH7A1)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102495542 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     102495542 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     102495542 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102495542
NCBI-ProteinID: XP_006145587
LinkDB All DBs
Position
Un
AA seq 566 aa AA seqDB search
MGSPGRGAGLYFSRCPPRRPSAGPGLSMWRLPRAICVHAAKTSQLPGPWNRPAAFMSTLL
INQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASMVDYEETVK
KAREAWKVWADIPAPKRGEIVRQIGDALREKIQVLGNLVSLEMGKILVEGVGEVQEYVDI
CDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGN
VCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDKRVNLLSFT
GSTQVGKQVALLVQERFGRSLLELGGNNAIIVFEDADLSLVVPSALFAAVGTAGQRCTTA
RRLFLHENIHDEVVNRLKKAYAQIRVGNPWDSDVLYGPLHTKQAVSMFLGAVEAARKEGG
TVVCGGQVMDRPGNYVEPTIVTGLAHNASIAHTETFAPILYVFKFKEEEEVFAWNNEVQQ
GLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAW
KQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgggctctcccgggcggggggcggggctctatttcagccgctgcccccctcgcaggccc
agcgcaggcccagggctcagtatgtggcggctgccccgagcgatctgtgtgcacgccgca
aagaccagccagctcccgggaccttggaacaggcctgccgccttcatgtccactctgctg
atcaatcagccccagtacgcttggctgaaagagctggggctccgcgaggaaaacgagggc
gtgtataatggaagctggggcggccggggagaggttattacgacctattgtcctgctaac
aatgaaccaatagcgagagttcgacaggccagtatggtggactatgaagagaccgtaaag
aaagcaagagaagcctggaaagtctgggccgatattcctgctccaaagcgaggagaaata
gtaagacaaattggcgatgccttgcgggagaagattcaagtcctaggaaacctggtgtct
ttggagatggggaaaatcttagtggaaggtgtgggcgaagttcaagagtacgtggatatc
tgtgattacgcagttggcttgtcgcggatgattgggggacccatcctgccttcagagaga
cctggccatgcgctcattgaacagtggaaccctgtgggcctggttgggatcatcactgcg
ttcaatttccccgtggcagtgtacggttggaacaacgccattgcgatgatctgtgggaac
gtgtgtctttggaaaggagctccaacaacttccctcatcagcgtggctgtcacaaagata
atagccaaggttctggaggacaacaaactgcccggggccatttgttccttgacttgcggt
ggagcggatatcggcacagcaatggccaaagataagcgagtgaacctgctgtccttcact
gggagcactcaggtgggaaaacaggtggcccttttggtgcaggagaggtttgggagaagt
ttgttagaacttggaggaaacaatgccattattgtctttgaggacgccgacctcagctta
gttgtcccgtcagctctcttcgctgctgtggggacagccggccagaggtgtaccactgcc
cgacggctgtttttacatgaaaacatccatgatgaagttgtaaacagacttaaaaaggcc
tatgcacagatccgtgttgggaacccgtgggactccgacgttctctacgggcccctgcac
accaagcaggcggtgagcatgtttctgggagctgtggaagcagcaaggaaggaaggcggc
accgtggtgtgcggcggccaggttatggaccgtcctggaaactatgtcgagccaacgatt
gtgacaggtcttgcccacaatgcgtccattgcacacacagagactttcgctccaattctc
tacgttttcaaattcaaggaggaagaagaggtctttgcgtggaataatgaagtgcagcag
ggactttcgagtagcatcttcaccaaagatttgggtagaatcttccgctggcttggacct
aaaggatcagactgtggtattgtgaatgtcaatattcccacgagtggggctgagattgga
ggtgcatttggaggagaaaagcacacgggtggtggcagggagtctggcagtgacgcctgg
aaacagtacatgagacgatccacttgtaccatcaactacagtaaggaccttcctctggct
caaggcatcaagtttcagtag

DBGET integrated database retrieval system