KEGG   Tupaia chinensis (Chinese tree shrew): 102495986
Entry
102495986         CDS       T02978                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase 3
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00220  Arginine biosynthesis
tup00330  Arginine and proline metabolism
tup01100  Metabolic pathways
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04066  HIF-1 signaling pathway
tup04071  Sphingolipid signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04370  VEGF signaling pathway
tup04371  Apelin signaling pathway
tup04611  Platelet activation
tup04915  Estrogen signaling pathway
tup04921  Oxytocin signaling pathway
tup04926  Relaxin signaling pathway
tup04931  Insulin resistance
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102495986 (NOS3)
   00330 Arginine and proline metabolism
    102495986 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102495986 (NOS3)
   04371 Apelin signaling pathway
    102495986 (NOS3)
   04066 HIF-1 signaling pathway
    102495986 (NOS3)
   04020 Calcium signaling pathway
    102495986 (NOS3)
   04071 Sphingolipid signaling pathway
    102495986 (NOS3)
   04022 cGMP-PKG signaling pathway
    102495986 (NOS3)
   04151 PI3K-Akt signaling pathway
    102495986 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102495986 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102495986 (NOS3)
   04921 Oxytocin signaling pathway
    102495986 (NOS3)
   04926 Relaxin signaling pathway
    102495986 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102495986 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102495986 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102495986 (NOS3)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102495986 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 HTH_15
Other DBs
NCBI-GeneID: 102495986
NCBI-ProteinID: XP_006150279
LinkDB
Position
Un
AA seq 1203 aa
MGNLKSVTQEPGPPCGLGLGLGLGLCGKQGPASPASEPSRAPASPPPPQPAPDHSPPLTR
PPEAPRFPRVKNWEVGSIAYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQSRPPTSPPPPE
QLLSQARDFIHQYYSSIKRSGSQAHEQRLQEVETEVTATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCRSAQEMFTCLCNHIKYATNRGNLRSAITVFPQRCPGRGDF
RIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPE
LFTLPPELVLEVPLEHPKLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSTE
IGTRNLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVDHH
VATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWK
GSGAKGTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQGYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSP
RPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQASCETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAEGLQLLPGLSHVHRRKMFQATILSVENLQSSKSTRATILV
RLDTGGQEGLQYQPGDHIGICPPNRPGLVEALLSRVEDPPPPAEPPVAVEQLEKGSPGGP
PPGWARDPRLPPCTLRQALTFFLDITSPPSPRLLQLLSTLAEEPSEQQELEALSQDPRRY
EEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGELHLTVAVL
AYRTQDGLGPLHYGVCSTWLSQLKAGDPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAP
FRGFWQERLHDIESKGLQPAPMTLVFGCRCSQLDHLYRDEVQDAQQRGVFGRVLTAFSRE
PDSPKTYVQDILRTELAAEVYRVLCLERGHMFVCGDVTMATSVLQTVQRILATEGDMELD
AAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWALEPPGTDI
LSQ
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagcgtgacccaggagcccgggccaccctgcggcctggggctgggg
ctgggcctcgggctgtgcggcaagcagggtccagcttccccggcaagcgagcccagccgg
gctccagcatccccgcccccaccccaacccgcgccagaccacagccccccactaacccgg
cccccagaggcacccaggttcccccgtgtgaagaactgggaagtgggcagcatcgcctac
gacacgctcagcgcacaggcccaacaggatggaccctgcaccccaagacgctgcctgggc
tccctcgtatttccacggaagctgcagagccggccccccacgagccctccgccccctgag
cagctgctgagtcaggcccgggatttcatccaccagtactacagctctatcaagaggagc
gggtcccaggcccatgagcagcgtcttcaggaggtggagacagaggtgacagccacaggc
acctaccagcttcgggagagtgagctggtgttcggggccaagcaggcctggcggaatgcc
ccgcgctgcgtgggccggatccagtgggggaagctgcaggtgttcgatgcgcgggattgc
agatctgcccaggagatgttcacctgcctctgcaaccacataaaatatgccaccaaccga
ggcaacctccgctcggccatcacagtgttcccccagcgctgcccgggccgcggagacttc
cggatctggaacagccagctggtgcgctatgcaggctacaggcagcaggacggctctgtg
cgcggggacccggccaacgtggagatcaccgagctctgcattcagcacggctggacccca
gggaacggccgcttcgacgtgctgcccctgctgctccaggcccccgacgaacccccggag
ctcttcaccctgccccccgagctggtcctcgaggtgcccctggagcaccccaagctggag
tggttcgcggccctgggcctgcgctggtacgcactgccggccgtgtccaacatgctgctg
gagatcgggggcctggagttccccgcggcccctttcagcggctggtacatgagcacggag
atcggcacgcgcaacctgtgtgacccgcaccgctacaacatcctggaggacgtggctgtc
tgcatggacctggacacccggaccacctcgtccctgtggaaagacaaggctgcagtggag
attaacctggccgtgctgcacagctaccagctggccaaagtgaccattgtggaccaccac
gttgccaccgcatccttcatgaagcacctggagaacgagcagaaggcccggggcggctgc
cctgccgactgggcctggatcgtgccccccatctcgggcagcctcactcctgtcttccat
caggagatggtcaactacttcctgtcccctgccttccgctaccagccggacccctggaag
gggagtggagccaagggcaccggcatcaccaggaagaagacctttaaggaagtggccaat
gcggtgaagatctcggcctcgctcatgggcacagtgatggcaaagcgagtgaaggcgacc
atcctgtacggctctgagaccggccgggcccagggctacgcgcagcagctggggaggctc
ttccggaaggctttcgacccccgggtcctgtgcatggatgaatacgatgtggtgtctctc
gagcacgagacgctggtgttggtggtgaccagcacatttgggaatggggaccccccggag
aatggagagagcttcgcagcagccctgatggagatgtccggcccctacaacagctccccc
cggcctgagcagcacaaaagttacaaaatccgcttcaacagcgtctcctgctcagaccct
ctggtgtcctcttggcggcgaaagaggaaggagtccagtaacacagacagtgcaggggcc
ctgggcaccctcaggttctgtgtgttcgggctggggtcccgggcatacccccacttctgc
gcctttgcccgagcggtggacacgcggctggaagagctgggcggggagcggctgctgcag
ctcggccagggcgacgagctgtgtggccaggaggaggccttccgcggctgggcccaggcc
gccttccaggcctcctgtgaaactttctgtgtgggagaggatgccaaggccgccgctcga
gacatattcagccccaaacgaagctggaagcgccagcggtaccggctgagtacacaggcc
gagggcctgcagctgctgccaggcctcagccacgtgcacaggcggaagatgttccaggct
accatcctctcagtggaaaacctgcaaagcagcaagtccacccgggccacgatcctggtg
cgcctggacactggaggccaggaggggctgcagtaccagccgggggaccacataggcatc
tgcccgcccaaccggccgggcctggtggaggcactgctgagccgcgtggaggacccgccc
ccgcctgcagagcctcctgtggcagtggagcagctggagaagggcagccctggcggccct
cctcccggctgggcgcgggatccccggctgcccccgtgcacgctgcgccaggctctcacc
ttcttcctggacatcacctccccgcccagcccgcggctcctgcagctgctcagcaccctg
gccgaggagcccagcgagcagcaggagctggaggccctcagccaggacccccggcgctac
gaggagtggaagtggttccgctgccccacgctgctggaggtgctggagcagttcccatcc
gtggccctgccggccccactgctcctcacccagctgcccctgctccagccccggtactac
tcggtcagctctgcgcccagcgcccacccgggagagctgcacctcactgtggccgtgctg
gcatacaggacccaggatgggctgggccccctgcactacggagtctgctccacgtggctg
agccagctgaaggccggagaccctgtgccctgcttcatcagaggggctccctcctttcgc
ctgcctcctgaccccagcttgccctgcattctggtgggtcctggcaccggcatcgccccc
ttccggggattctggcaggagcggctgcacgacattgagagcaaaggactgcagcccgcc
cccatgactttggtgttcggctgccgctgctcccagctcgaccacctctaccgcgacgag
gtgcaggacgctcagcagcgcggggtgttcggccgcgtcctcaccgccttctcccgggag
cctgacagccccaagacctacgtgcaggacatcctgaggactgagctggcagctgaggtg
taccgcgtgctgtgcctcgagcggggccacatgtttgtctgcggcgatgtcaccatggca
acaagcgtcctacagacagtgcagcgaatcctggcgacggagggcgacatggagctggac
gcggcgggagatgtcatcggcgtgctgcgggatcagcaacgctaccacgaggacattttc
gggctcacgctgcgcacccaggaagtgacaagccgcatacgcacccagagcttttcgctg
caggagcggcagctgcggggcgcagtgccctgggcgttggagcctcctggcacagacatc
cttagccagtga

DBGET integrated database retrieval system