KEGG   Tupaia chinensis (Chinese tree shrew): 102497099
Entry
102497099         CDS       T02978                                 

Definition
(RefSeq) cytochrome P450 4A11
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00071  Fatty acid degradation
tup00590  Arachidonic acid metabolism
tup00830  Retinol metabolism
tup01100  Metabolic pathways
tup03320  PPAR signaling pathway
tup04270  Vascular smooth muscle contraction
tup04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102497099
   00590 Arachidonic acid metabolism
    102497099
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102497099
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102497099
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102497099
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102497099
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tup00199]
    102497099
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     102497099
Cytochrome P450 [BR:tup00199]
 Cytochrome P450, animal type
  CYP4 family
   102497099
SSDB
Motif
Pfam: p450 UPF0181
Other DBs
NCBI-GeneID: 102497099
NCBI-ProteinID: XP_006164318
LinkDB
Position
Un
AA seq 512 aa
MSVSLRSLSSFPGSLDRFLQGVSLLGLLLLLLKAAQLYLHRQWLLRALQQFPSPPSHWLF
GHNYELQKDQELQEILKWAEKFPSACPRWLWGSKVLFQVYDPDYMKVILGRSDPKVDNIH
RFLKPWIGHGLLLLEGQKWLQHRRMLTPAFHFDILKPYVRFMADSVQVMLDKWENLTDQD
TPLEILGHMSMMTLDTMMKCAFSYQGRGQMDRHSQSYIQAIRDMGNQIFSRVRNVFYQND
IIYRLTPAGRRAIQNCQIVHEHTDRVIQLRKVHLQEAGELEKVRGRRHLDFLDILLLAQA
ESGSNLSDQDLRAEVDTFMFEGHDTTASGISWVLYALATHHEHQQRCREEIQSLLGDGTS
ISWEHLDQMPYTTMCIKEALRLYPPVPVVGRDLSKPITFPDGRSLPEGISVSLSFYALHH
NPEVWPNPEVFDPSRFAPGSTRHSHAFLPFSAGSRNCIGKQFAMNELKVAVALTLLRFEL
LPDPSRVPNPIARIVLKSSNGIHLRLRKLRSP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgagcgtctctctgcggagcctcagcagcttcccaggcagcctggacaggttcctccaa
ggggtctccctgctgggcctgctgctgctgctgcttaaggcagcccagctctacctgcac
aggcagtggctgctcagagccctccagcagttcccatcccctccttctcactggctcttc
gggcacaactatgagttgcaaaaggaccaggagctgcaagagattctgaaatgggcagag
aaattcccaagtgcctgtcctcgttggctatgggggagcaaggtccttttccaagtctat
gacccagactacatgaaggtgattctggggagatcagacccaaaggttgataatatccac
agattcctgaaaccatggattgggcatggtttactcctgttggaagggcagaagtggctc
caacaccgccggatgctgaccccagccttccactttgacatcctcaagccctacgtgagg
ttcatggcagactccgttcaagtgatgctggacaaatgggagaacctcactgaccaggac
actcctctggagatcttaggacacatgtccatgatgaccttggacaccatgatgaagtgt
gccttcagttatcagggcagaggccagatggacaggcattcccagtcctacatccaggcc
atcagagatatgggaaaccaaatattttctcgtgtgaggaatgtcttttaccagaatgac
atcatctacaggctgacccctgctggccgccgtgctatccaaaactgccagattgtccat
gagcacacagacagagtgatccagctgaggaaggttcacctgcaggaggctggagagctg
gagaaggtcagagggaggaggcatttggacttcctggacatcctccttctggcccaagct
gaaagtgggagcaacttgtctgaccaggacctccgtgctgaagtggatacattcatgttc
gaaggtcatgacaccacagccagtggcatctcctgggtcctctatgctttggccactcac
cacgagcatcaacagaggtgccgagaggaaatccagagtctcctgggggatggcacctcc
atctcctgggaacatctggaccagatgccctacaccaccatgtgcatcaaggaggccctg
agactctaccctccagtacctgttgttggcagagacctcagcaaaccaatcaccttccct
gatgggcgctccttacccgaaggtatctcggtctcactgtccttctatgcccttcaccac
aacccagaggtgtggccaaacccagaggtgttcgacccttcccgctttgcaccaggttct
actcgacacagtcacgctttcctgcccttctcagcagggtccaggaactgcattgggaaa
caatttgccatgaacgagctgaaggtggccgtggccctgaccctactccgctttgagctg
ctgccggatccctccagggtccccaacccaatagcacgtatcgtgttgaagtccagcaat
ggtatccacctgcgtcttaggaagctccgctcaccctga

DBGET integrated database retrieval system