KEGG   Tupaia chinensis (Chinese tree shrew): 102497672
Entry
102497672         CDS       T02978                                 

Gene name
SLC4A2
Definition
(RefSeq) solute carrier family 4 member 2
  KO
K13855  solute carrier family 4 (anion exchanger), member 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    102497672 (SLC4A2)
   04971 Gastric acid secretion
    102497672 (SLC4A2)
   04972 Pancreatic secretion
    102497672 (SLC4A2)
   04976 Bile secretion
    102497672 (SLC4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102497672 (SLC4A2)
Transporters [BR:tup02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   102497672 (SLC4A2)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto IFRD PTS_EIIA_2
Other DBs
NCBI-GeneID: 102497672
NCBI-ProteinID: XP_014443979
LinkDB
Position
Un
AA seq 1693 aa
MPKNKKRNTPHRGGGGSSGGGSGAAAAAAATAGGQHRNVQPFSDEDASIETMSHCSGYSD
PSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNVLASKMLYEFI
LERRMTLTDSIERCLKKGKSDEQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICD
GTASIQARQTCSTCFGVCCFIATDDITELYSTLECLENIFSKSYLKDKDTNVVCSTPNTA
LHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDVNMRIAAGESLALLFELARG
MESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERDFPTETVKFA
LCFTHVASFLRPEFHDHPGACVALSGISSVEAGSFPPRGAVMEPRDGVPRRRNPERGSSE
RRPRGAWTEGQRGGFLARGSRCLVVPGQAPPPPDFGPGSRLPACGGGAAHDSFRTPQQES
LGAGPDGFPEHEEDELHRTLGVERFEEILQEAGSRGGEEPGRSYGEEDFEYHRQSSHHIH
HPLSTHLPPDARRRKTPQGPGRKPRRRPGASPTGETPTIEEGEEDEDETSEAEGARALTQ
LSPAPTSSSVQFFLQEDEGTDRKAEKTSPSPPAPLPHQEAALRATKGAQTGDPAEEVVAV
ASGTAGGDDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGGEQALLPRVPTDESEAQTLA
TADLDLMKSHRFEDVPGVRRHLVRKNAKGPVQSGREGPGPTPRTRPRAPHKPHEVFVELN
ELLLDKNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLD
LDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKDFSFPRNISAGSLG
SLLGHHHGQGAESDPHVTEPLIGGVPETRLEVERERELPPPAPPAGITRSKSKHELKLLE
KIPENAEATVVLVGCVEFLSRPTMAFVRLRDAVELDAVLEVPVPVRFLFLLLGPSSANMD
YHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGEELLRSVAH
FQRQMLKKREEQGRLLPAGAGLEPKSAQDKALLQMVEATGTAEDDPLRRTGRPFGGLIRD
VRRRYPHYLSDFRDALDPQCLAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTA
LQGVAFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNQLEYLVGRVWIGFWLVLLALLMV
ALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLVKIFQEHPLHGCSVSNGSETDSSEN
TTWAGAGTALGLGNGSTAGHPGQGRPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFP
GRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQKLSVPSGFSVTAPEKRGWVINPLGEKSP
FPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGVCAL
FGLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSLVIGD
LLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKVRTLRMHLFTA
LQLLCLALLWAVMSTAASLAFPFILILTVPLRMVVLTRIFTEREMKCLDADEAEPVFDER
EGVDEYNEMPMPV
NT seq 5082 nt   +upstreamnt  +downstreamnt
atgccgaagaataagaagcggaacacgccccaccgcggcggcggtggcagcagcggcggc
ggctcaggggcagctgcagcggcggcggcgacagcaggtggccaacatcgaaatgtccag
ccttttagtgatgaggatgcatcgattgaaacaatgagccattgcagtggttacagcgat
ccttccagttttgccgaagacggaccagaagtcctcgatgaggaaggaacacaagaagac
ttagagtacaagttgaagggattaattgaccttaccctggataagagtgcgaagacaagg
caagcagctcttgaaggtattaaaaatgtgctggcttcaaaaatgctttatgaatttatt
ctggaaagaagaatgactttaactgacagcattgaacgctgcctgaaaaaagggaagagt
gatgagcagcgagcagcagcagctttagcgtctgtgctttgtattcagctgggccctgga
atcgaaagtgaagagattttaaaaactcttggacccatcctaaagaagataatctgtgat
gggacagccagtatccaggctaggcaaacttgttcaacatgtttcggtgtttgctgtttt
attgccacagatgacattactgagctctactcaactctggaatgtctggaaaatatcttc
agcaagtcctatctcaaagacaaagacactaatgttgtttgcagcacccctaacacagca
cttcacatcagctcgcttctggcgtggaccttgttactcaccatatgcccaatcaatgaa
gtgaagaaaaagcttgagatgcatttccataaacttccaagcctgctctcttgtgatgat
gtaaatatgagaatagctgctggcgagtctttggcacttctgtttgaattggccagagga
atggagagtgacttcttttatgaagatatggagtctttgactcagatgcttcgggctctg
gctacagatggaaataagcaccgggccaaagtggacaagagaaagcagcggtcggtgttc
cgagatgtcctgagggcagtagaggaacgggattttccaacagaaactgttaaatttgcg
ctgtgcttcacccacgtggcatccttcctacggcccgaatttcatgaccatcctggtgcc
tgcgtcgccctgtcagggatctccagcgttgaagcgggctcctttccgcccagaggtgcc
gtaatggagccaagagacggcgtcccgaggcgccggaaccccgagcggggaagctcggag
cggcgacctcgcggggcctggaccgaaggacagcggggtggcttcctggcgcggggctcc
cggtgtctggtagtgcctggacaagctcccccgccccctgatttcgggcccggctcccgc
ctcccagcctgcggcggcggggccgcgcacgattctttccgcactccacagcaggagagc
ttaggtgctggacctgatgggttcccagagcacgaggaggatgaacttcaccgcaccctg
ggcgtggagcgctttgaggagatcctgcaggaggcggggtctcgcggcggggaggagcca
ggccgcagctatggggaggaagactttgaataccaccgacagtcctcccaccacatccat
cacccgctctccacccacctgccgccggatgcccgccgccgcaagacaccccagggtcca
ggacggaagcctcgaaggcgccctggagcctctcccactggggagacccccaccattgag
gagggggaggaagatgaggatgagaccagtgaggctgagggggcccgggcactgactcag
ctgtcccctgcccccacatcctcttcagtgcagttctttctccaagaggatgaaggcact
gacaggaaggcagagaagaccagcccgtctccccctgcacctctgccgcaccaggaggca
gctctccgagccaccaaaggggcccagactggagacccagctgaagaggtggtggcggtg
gccagtggcacagctggaggcgatgatggaggtgcctcgggacgccccctgcccaaagcc
cagcctgggcatcgcagctacaacctgcaggagaggaggcgcattgggagcatgaccgga
ggcgagcaggccttgctgccccgggtccccacggacgagagcgaggcccagacgctggcc
acggccgacctggacctcatgaagagtcaccggtttgaggacgttcccggggtgcggcgg
cacttggtgcggaagaacgccaaagggccagtgcagagtggccgggaagggcctggcccc
acgcctcggacccgaccccgggccccccacaagcctcacgaggtgtttgtggaactgaat
gagttactgctggacaagaaccaggaacctcagtggcgggagacagcacgctggatcaaa
tttgaggaggatgtggaagaggagacagagcgctgggggaagccccacgtggcctccctc
tccttccgcagtctcctggagctccgccgaaccctggcccatggggctgtgctcctggac
ctggaccagcagaccctaccaggggtggcccaccaggtggtggagcagatggtcatctcc
gaccagatcaaggccgaggacagagccaacgtgctgcgggccctgctgctgaaacacagc
cacccaagcgatgagaaggatttctccttcccccgtaacatctccgctggctccctgggc
tccctgctgggccatcaccatggccagggagctgaaagtgacccccatgtcaccgagcct
ctcatcggaggtgttccagagacccggctagaggtggagcgagagcgtgagctgccacca
cctgccccgccggctggcatcacccgctccaagtccaaacacgagctgaagctgctggag
aagatccccgagaatgcggaggccaccgtggtcctagtcggctgtgtggaattcctctcc
cgtcccaccatggccttcgtgcggctgcgggatgcggtggagctggacgccgtgttggag
gtgcctgtgcctgtgcgcttcctcttcctgctgctgggcccaagcagcgccaacatggac
taccatgagatcggccgctccatctccaccctcatgtccgacaagcaattccacgaggcg
gcctacctggccgacgagcgggaggacttgctgaccgccatcaacgccttcttggactgc
agcgtggtgctgccgccctcggaggtgcagggcgaggagctgctgcgctcggtcgctcac
ttccagcgccagatgctcaagaagcgcgaggagcagggccggctgctgcctgcaggggca
gggctggagcccaagtccgcccaggacaaggcgctcctgcagatggtagaggcgacaggt
acagccgaagacgatccccttcgacggacaggccggcctttcggagggctgatccgggac
gtgcggcgccgctacccccactacctgagtgatttccgcgacgcgctcgacccccagtgc
ctagctgctgtgatcttcatctacttcgcagctctgtctccagccatcaccttcgggggg
ctgctgggagagaagacccaggacctgattggggtgtcagagctgatcatgtccacggcg
ctgcagggcgtggccttctgcctgctgggtgcccagccgctgctggtgattggcttctcg
ggacccctgctggtcttcgaggaggccttcttctcgttctgcagcagcaaccagctggag
tacctggtgggccgcgtgtggatcggcttctggctggtgctcctggcactgctcatggtg
gcgctggagggcagcttcctggtgcgcttcgtgtcccgcttcacccaggagatcttcgcc
ttcctcatctcactcatcttcatctacgagaccttctacaagctggtcaagatcttccag
gagcaccccctccacggctgctcggtctccaacggctcagagacagacagcagcgagaat
acaacgtgggctggggcagggactgcgctggggctgggcaacgggagcacagctgggcac
ccagggcaggggcggccccggggccagcccaacacggccttgctgtccctggtgctcatg
gccggcactttcttcatcgccttcttcctgcgcaaattcaagaacagccggttcttccct
ggccggatccggcgggtgattggtgactttggggtgcccatcgcgatcctcatcatggtg
ctcgtggattacagtattgaggacacctacacccagaagctgagtgtgcccagtggcttc
tcggtgacagccccagagaagcggggctgggtcatcaaccctctgggagagaagagcccc
ttccccgtgtggatgatggtggccagcctgctgccggccatcttggtcttcatcctcatc
ttcatggagacacagattaccacgctgatcatctccaagaaggagcgcatgctgcagaag
ggctcgggcttccacctggacctgctgctcattgtggccatgggtggtgtctgtgccctc
tttggcctgccctggctggctgctgccaccgtccgctctgtcactcatgccaacgcgctc
accgtcatgagcaaggctgtggctcctggggacaagcccaagattcaggaggtcaaggag
cagcgggtgacagggctgctagtcgccctgctcgtgggcctttccctggtcatcggagac
ctgctccggcagatccccctggctgtgctcttcgggatcttcctatacatgggtgtcacc
tccctgaacgggatccagttctacgagcggctacacctgctgctcatgccacccaaacac
cacccggacgtcacctacgttaagaaggtccggactctccgaatgcacctgttcacagcc
ctgcagctgctctgcctggccctgctctgggctgtcatgtccacagctgcctccctggcc
ttccccttcatcctcatcctcacagtgccgctccgcatggtggtcctcacccgcatcttc
accgagcgagagatgaaatgtctggacgcggacgaggccgagccggtgttcgatgagcgg
gagggtgtggatgagtacaacgagatgcccatgcctgtgtag

DBGET integrated database retrieval system