KEGG   Tupaia chinensis (Chinese tree shrew): 102497817
Entry
102497817         CDS       T02978                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04915  Estrogen signaling pathway
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05223  Non-small cell lung cancer
tup05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102497817 (TGFA)
   04012 ErbB signaling pathway
    102497817 (TGFA)
   04014 Ras signaling pathway
    102497817 (TGFA)
   04151 PI3K-Akt signaling pathway
    102497817 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102497817 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102497817 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102497817 (TGFA)
   05212 Pancreatic cancer
    102497817 (TGFA)
   05225 Hepatocellular carcinoma
    102497817 (TGFA)
   05214 Glioma
    102497817 (TGFA)
   05211 Renal cell carcinoma
    102497817 (TGFA)
   05215 Prostate cancer
    102497817 (TGFA)
   05223 Non-small cell lung cancer
    102497817 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102497817 (TGFA)
SSDB
Motif
Pfam: EGF TMEM154
Other DBs
NCBI-GeneID: 102497817
NCBI-ProteinID: XP_006151336
LinkDB
Position
Un
AA seq 159 aa
MVTSAGQLALLALGIVLAVCQALENSTSPLSDPPVAAAVLSHFNECPDSHTQFCFHGTCR
FVVQEDKPACVCHSGYIGARCEHADLLAVVAASQKKQAITALVVVSLVALAILIITCVLI
HCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctgctcgcgctgggtatcgtgctggccgtgtgc
caagccctggagaacagcacgtcccctctgagtgacccacctgtggccgcagcagtgctg
tctcattttaatgagtgcccagattcccacactcagttctgcttccatggaacctgcagg
tttgtggtgcaggaggacaagccagcatgtgtctgtcattccggatatattggtgcacgt
tgtgagcatgcagacctcctggccgtggtggccgccagccagaagaagcaggccatcacc
gccttggtggtggtgtccctcgtggccttggccatcctcatcatcacgtgtgtgctgata
cactgctgccaggtccgaaaacactgtgagtggtgtcgggctctggtctgccggcatgag
aagcccagtgccctcctgaagggaaggactgcttgctgccactccgagacagtggtctga

DBGET integrated database retrieval system