KEGG   Tupaia chinensis (Chinese tree shrew): 102498069
Entry
102498069         CDS       T02978                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04140  Autophagy - animal
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04370  VEGF signaling pathway
tup04510  Focal adhesion
tup04722  Neurotrophin signaling pathway
tup04910  Insulin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup05010  Alzheimer disease
tup05014  Amyotrophic lateral sclerosis
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05145  Toxoplasmosis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05165  Human papillomavirus infection
tup05168  Herpes simplex virus 1 infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05223  Non-small cell lung cancer
tup05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102498069 (BAD)
   04014 Ras signaling pathway
    102498069 (BAD)
   04370 VEGF signaling pathway
    102498069 (BAD)
   04024 cAMP signaling pathway
    102498069 (BAD)
   04022 cGMP-PKG signaling pathway
    102498069 (BAD)
   04151 PI3K-Akt signaling pathway
    102498069 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102498069 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    102498069 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102498069 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102498069 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102498069 (BAD)
   04919 Thyroid hormone signaling pathway
    102498069 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102498069 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102498069 (BAD)
   05203 Viral carcinogenesis
    102498069 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102498069 (BAD)
   05212 Pancreatic cancer
    102498069 (BAD)
   05225 Hepatocellular carcinoma
    102498069 (BAD)
   05221 Acute myeloid leukemia
    102498069 (BAD)
   05220 Chronic myeloid leukemia
    102498069 (BAD)
   05218 Melanoma
    102498069 (BAD)
   05211 Renal cell carcinoma
    102498069 (BAD)
   05215 Prostate cancer
    102498069 (BAD)
   05213 Endometrial cancer
    102498069 (BAD)
   05223 Non-small cell lung cancer
    102498069 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102498069 (BAD)
   05014 Amyotrophic lateral sclerosis
    102498069 (BAD)
   05020 Prion disease
    102498069 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    102498069 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102498069 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102498069 (BAD)
   05161 Hepatitis B
    102498069 (BAD)
   05160 Hepatitis C
    102498069 (BAD)
   05162 Measles
    102498069 (BAD)
   05168 Herpes simplex virus 1 infection
    102498069 (BAD)
   05165 Human papillomavirus infection
    102498069 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102498069 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102498069 (BAD)
   01524 Platinum drug resistance
    102498069 (BAD)
   01522 Endocrine resistance
    102498069 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 102498069
NCBI-ProteinID: XP_006149893
LinkDB
Position
Un
AA seq 243 aa
MFQIPEFEPSEQEDSSSADRGLGPNPAGDQPPAPGKHRKKAPGLPGDASHRQEQPTSSSH
HEGAVAAETRSRHSSYPAGNEEDEGLEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FEDSFKFQDQPHAPPSICSFQVSGHAEIWSPDPPPGTSSPEERGHSDADAAELELDAHLP
VLVGSKFGERRLRSLPVTSRPTFPRPHPLPPPLAAILGVGGSLFRSPVQKGSVLSLSEKG
GLT
NT seq 732 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagccaagtgagcaggaagactccagctctgcagatagg
ggcctgggccccaaccccgcaggggaccagcccccagctcctggcaaacaccgcaaaaag
gccccaggcctcccgggagacgccagtcaccggcaggagcagccaaccagcagcagccac
catgaaggcgccgtggctgcggagacgcggagtcgccacagttcataccccgcagggaac
gaggaggatgaggggttggaggaggaacccagccccttccggggccgctcgcgctcggcg
ccccccaacctctgggctgcacagcgctatggccgcgagctccggaggatgagcgacgag
ttcgaggactccttcaagttccaggaccagccccacgccccgccatcaatctgctccttc
caagtctcaggacatgccgagatctggagtccggaccctcctccagggacttcctcgccc
gaagagcgcgggcacagcgacgcagatgcggcagagctcgagctggacgcgcatcttcca
gtcctggtgggatcgaaatttggggagaggaggctccgttccctcccagtgacctctcgt
cccacattcccgagaccccacccgctcccgccgccgttggcggccatcttgggtgtgggc
ggaagtcttttccgcagtcctgtgcaaaaagggtctgttctgtccctttcggagaaaggc
ggtctgacctag

DBGET integrated database retrieval system