KEGG   Tupaia chinensis (Chinese tree shrew): 102498407
Entry
102498407         CDS       T02978                                 

Gene name
SMO
Definition
(RefSeq) smoothened, frizzled class receptor
  KO
K06226  smoothened
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04340  Hedgehog signaling pathway
tup04360  Axon guidance
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102498407 (SMO)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    102498407 (SMO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102498407 (SMO)
   05205 Proteoglycans in cancer
    102498407 (SMO)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102498407 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tup04030]
    102498407 (SMO)
G protein-coupled receptors [BR:tup04030]
 Frizzled / Smoothened family
  102498407 (SMO)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 102498407
NCBI-ProteinID: XP_006158905
LinkDB
Position
Un
AA seq 789 aa
MAAARPAWGLELPLLGLLLLPFLGVPGRGAALSGNATGPGPRSTGGSARRSAAVTGPPPL
LSHCGRAAPCEPLRFNVCLGSALPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWA
VIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPEGCPN
EVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIATFGAV
TGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMVGARREIVCRADGT
MRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYF
HLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLI
RGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEW
ERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKA
TLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSLHTVSHDGPV
AGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEQANLWLVEAE
ISPELEKRLGRKKKRRKRKKEVCPLVPPPELQHATPAPARSAVPRLPQLPRQKCLVATGS
WGAGDSCRQGAWTLISNPFCPEPSPLQDPFLPSAPAPTAWAQGRRQGLGPIHSRINLMEA
ELMDADSDF
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggccgctgcccgccccgcgtgggggctggagctcccgctcctggggctgctgctgctg
ccgtttctgggagtcccgggccgaggggcggctttgagcgggaacgctactgggcctggg
ccgcggagcaccggcgggagcgcgagaaggagcgcggcggtgaccggccctccgccgctg
ctgagccactgcggccgggccgccccctgcgagccgctgcgcttcaacgtgtgcctgggc
tcggcgctgccctacggggccacctccacgctgctggccggggactcggactcccaggag
gaagcgcacggcaagctcgtgctctggtcgggcctccgaaatgccccccgctgctgggca
gtgatccagcccctgctgtgtgccgtgtacatgcccaagtgtgagaatgaccgggtggag
ctgcccagccgcaccctctgccaggccacccgaggtccctgtgccatcgtggagagggag
cggggctggcccgacttcctgcgctgcacgcccgaccacttccctgaaggctgcccgaat
gaggtgcagaacatcaagttcaacagctcgggccagtgtgaggcacccttggttcggact
gacaaccccaagagctggtacgaggacgtggagggatgtgggatccagtgccagaacccg
ctcttcacagaagcggagcaccaggacatgcacagctacatcgccaccttcggggccgtc
acgggcctctgcacgctcttcactctggccacctttgtggctgactggcggaactcgaat
cggtaccccgcagttattctcttctacgtcaatgcatgtttctttgtgggcagcattggc
tggctggcccagttcatggtgggagcccgccgggagatcgtctgccgtgcagatgggacc
atgaggctcggggagcccacctccaacgagaccctgtcctgtgtcatcatcttcgtcatt
gtgtactatgccctgatggctggcgtggtctggtttgtggtccttacctatgcctggcac
acctccttcaaagccctgggcaccacctaccagcctctctccggcaagacctcctacttc
cacctgctcacctggtcactcccctttgtcctcactgtggcaatcctcgctgtggcccag
gtggacggggactccgtgagcggcatctgttttgttggctacaagaactaccggtaccgt
gctggcttcgtgctggccccgattggcctggtgctgattgtgggtggctacttcctcatc
cggggagtcatgactctgttctccatcaagagcaatcatcccgggctgctgagtgagaag
gctgccagcaagatcaacgagaccatgctgcgcctgggcatttttggcttcctggccttt
ggctttgtgctcatcaccttcagctgccacttctacgacttcttcaatcaggccgagtgg
gagcgcagcttccgggactacgtgctgtgccaggccaatgtgaccatcgggctgcccacc
aagaagcccatccccgactgtgagatcaagaatcggcctagcctcctggtggagaaaatc
aacctgttcgccatgtttggaaccggcattgccatgagcacctgggtctggaccaaggcc
acgctgctcatctggaggcgcacctggtgcaggttgactgggcagagtgatgacgagccc
aagcggattaagaagagcaagatgatcgccaaggccttctccaagcggcgtgagctgctg
cagaaccctggccaggagctctccttcagcctgcacaccgtctcccacgacgggcctgtg
gctggtttggcctttgacctcaatgaaccctcagccgatgtctcctctgcctgggctcag
catgtcaccaaaatggtggcccggagaggggccatcctgccccaggatgtgtctgtcact
cctgtggcaactccagtgccccccgaggaacaagccaacctgtggctggttgaggcagag
atctctccagagctggagaagcgcctgggccggaagaagaagcggaggaagaggaagaag
gaggtgtgcccattggtgccaccccctgagctccagcacgccacccccgcccctgcccgc
agtgccgttcctcggctgcctcagctgccccggcagaaatgcctggtggccacaggctca
tggggagctggggactcctgccgacagggagcctggaccttgatctccaaccccttctgc
ccagagcccagcccccttcaggatcccttcctgcccagcgccccggcccccacggcctgg
gctcagggccgccgacagggcctggggcccattcactcccgcatcaacctgatggaggca
gagctcatggatgcagactccgacttctga

DBGET integrated database retrieval system