KEGG   Tupaia chinensis (Chinese tree shrew): 102498510
Entry
102498510         CDS       T02978                                 

Gene name
SCTR
Definition
(RefSeq) secretin receptor
  KO
K04588  secretin receptor
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04080  Neuroactive ligand-receptor interaction
tup04972  Pancreatic secretion
tup04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102498510 (SCTR)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102498510 (SCTR)
   04976 Bile secretion
    102498510 (SCTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tup04030]
    102498510 (SCTR)
G protein-coupled receptors [BR:tup04030]
 Secretin receptor family
  Gut peptide
   Secretin
    102498510 (SCTR)
SSDB
Motif
Pfam: 7tm_2 HRM Insulin_TMD
Other DBs
NCBI-GeneID: 102498510
NCBI-ProteinID: XP_006169657
LinkDB
Position
Un
AA seq 445 aa
MRPCLWLLQLLLLHRAAHTAGALPRLCDVLRVLQEEQDQCLQELSRERTADLGMEQPVPG
CATLWDNMSCWPSSAPGQTVEVECPRFLQMLTSGNGSMFRNCTQDGWSEAFPRPDVACGV
NMSGSSNERRHTYLLKLKVMYTVGYSASLSMLLVALSILCAFRRLHCTRNYIHMHLFGSF
ILRALSIFIKDAVLFSSDDIAYCDSPRVGCKLVMVFFQYCIMANYAWLLVEGLYLHTLLV
ISFFSERKCLQGFVALGWGSPAVFVTLWALIRHFLEDNGCWDINANAAIWWVIRGPVILS
ILINFILFINILRILMRKLRTQETRGNEVNHYKRLAKSTLLLIPLFGIHYIVFAFSPEDA
MEIQLFFELALGSFQGLVVAILYCFLNGEVQLEVQRKWRQWHQHEFPLRTMALSSSFSNS
PSGLTQSTKASTSGQSRDICRASVI
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcgaccctgcctttggctgttgcagctgctgctgcttcaccgcgctgcgcacacagct
ggagccctcccccggctgtgtgatgtgctgcgggtgctgcaagaggaacaagaccagtgt
ctgcaggaactctccagagagcggacagcagacctgggcatggagcagccagtgccaggc
tgtgcaacactctgggacaacatgagctgctggccctcctctgccccaggacagacagtg
gaagtggagtgcccgcgattcctccagatgctcacaagtggcaacggttccatgtttcga
aactgtacgcaggacggctggtcagaagccttccccagacctgacgtggcctgtggggtt
aacatgagcggctcttccaacgagaggcggcacacctacctgctgaagctgaaggtcatg
tacaccgtgggctacagcgcctccttgtcgatgctcctggtcgccctcagcatcctgtgc
gctttccggagactccactgcactcgcaactacatccacatgcacctgtttgggtccttc
atcctgcgtgccctgtccatcttcatcaaagatgcggtgctcttctcctctgatgacatc
gcctactgcgacagccccagggtgggctgtaagctggtcatggttttcttccagtactgc
atcatggccaactatgcctggctgctggtggaaggtctctacctgcacacacttctcgtc
atctccttcttctcagaaaggaagtgcctccagggatttgtcgcccttggatggggttct
ccagctgttttcgttactttgtgggctctcatcaggcactttctggaagacaatgggtgc
tgggacatcaatgccaatgcagccatctggtgggtcattcgaggccctgtgatcctctcc
atcctgattaatttcatcctttttataaacatcctaagaatcctaatgagaaaactaaga
acacaagaaacaagaggaaatgaagtgaaccattacaaacggctggccaagtcgaccctc
ctgctgatccctctttttggaatccactacatcgtctttgctttttccccggaggacgcc
atggagatccagctgttttttgaactggcccttggctcattccaggggttggtggtggcc
attctctactgcttcctcaacggggaggtgcagctggaggttcagaggaagtggcggcag
tggcaccagcatgagttcccactgcgcacgatggccctcagctcttccttcagcaacagt
cccagtgggctcacccagagcaccaaggccagcacctcagggcagagtcgggacatctgc
agggcaagcgtcatctga

DBGET integrated database retrieval system