KEGG   Tupaia chinensis (Chinese tree shrew): 102498709Help
Entry
102498709         CDS       T02978                                 

Gene name
PRSS2
Definition
(RefSeq) protease, serine 2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04080  Neuroactive ligand-receptor interaction
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
tup05164  Influenza A
Brite
KEGG Orthology (KO) [BR:tup00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102498709 (PRSS2)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    102498709 (PRSS2)
   04974 Protein digestion and absorption
    102498709 (PRSS2)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102498709 (PRSS2)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102498709 (PRSS2)
Peptidases [BR:tup01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102498709 (PRSS2)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102498709 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 102498709
NCBI-ProteinID: XP_006145138
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MNPLFILALVGAAVAFPTNDDDDKIVGGYTCEENSVPYQVSLNSGYHFCGGSLISDQWVV
SAAHCYKSRIQVRLGEHNIDVVEGNEQFINSAKVIRHPKYNSWTLDSDIMLIKLSSPAAL
NTRVSTISLPSACAPAGTQCLISGWGNTLSSGSNYPELLQCLDAPLLSEAECEASYPGQI
TETMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKGRPGVYTKVCQFVDWI
QETIAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaacccactcttcatcctcgcccttgtgggagctgctgttgccttccccactaacgac
gacgatgacaagatcgtcgggggctacacctgtgaggagaactccgtcccctaccaggtg
tccctgaattccggctaccacttctgcggaggctccctcatcagcgatcagtgggtggtg
tccgccgctcactgctacaagtcccgcatccaggtgaggctgggagagcacaacatcgac
gtcgtggagggcaatgagcagttcatcaactccgccaaggtcatccgccaccctaagtac
aacagctggaccctggacagtgacatcatgctcatcaagctctcctcgcctgcagccctc
aacacccgggtgtccaccatctctctgccctccgcctgtgcgcccgcaggcacccagtgc
ctcatctccggctggggcaacaccctgagctctggcagtaactacccagagctgctgcag
tgcctggacgctcctctgctgagcgaggctgagtgcgaagcctcctaccccgggcagatc
actgagaccatggtctgcgctggcttcctggagggaggcaaggattcctgccagggtgac
tctggtggccccgtggtctgcaatggagagctccagggtattgtctcctggggctacggc
tgtgctcagaagggcaggcctggcgtctacaccaaggtctgccagtttgtggactggatc
caggagaccatcgctgccaactga

DBGET integrated database retrieval system