KEGG   Tupaia chinensis (Chinese tree shrew): 102498867Help
Entry
102498867         CDS       T02978                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00512  Mucin type O-glycan biosynthesis
tup01100  Metabolic pathways
Module
tup_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102498867 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tup01003]
    102498867 (GALNT9)
Enzymes [BR:tup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102498867 (GALNT9)
Glycosyltransferases [BR:tup01003]
 O-Glycan biosynthesis
  Mucin-type
   102498867 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102498867
NCBI-ProteinID: XP_006147398
LinkDB All DBs
Position
Un
AA seq 463 aa AA seqDB search
MCRRASYPGDLPQISVVFIFVNEALSVILRSVHSVVNHTPSQLLKEVVLVDDNSDNAELK
ATLDQYVSSRYPGLVKVVRNSRREGLIRARLQGWKVATAPVVGFFDAHVEFNTGWAEPAL
ARIREDRRRIVLPAIDNIKYDTFEVQQYASAAHGYNWGLWCMYIVPPQDWLDRGDEAAPI
RTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENIELGMRVWQCGGSMEVLPCSRVAHIE
RTRKPYSGDIDYYARRNALRAAEVWMDGFKSHVYMAWNIPMTNPGVDFGDVSERLALRRR
LKCRSFKWYLDNVYPEMRVYNDTLTYGEVRNSKASGYCLDQGAEDDDQAILYPCHGMSSQ
LVRYSAEGLLQLGPLGSTAFLPDSRCLVDSGGRTPTLRKCEDVARPTQRLWDFTQSGPIV
SRDTGRCLELELSKGASFGLRLVLQRCSGQKWMIRNWIRPGRH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagacgggcatcctaccccggggacctgccgcagatctcggtggtcttcatcttc
gtcaacgaggccctgtcggtcatcctgcgctcggtgcacagcgtggtcaaccacacgccc
tcccagctcctcaaggaggtcgtcctggtggacgacaacagcgacaatgcggagctcaag
gccactctggaccagtacgtgagcagcaggtaccccgggctagtgaaggtcgtgcgcaac
agcaggagggaaggcttgatccgggcgcggctgcagggctggaaggtggccacggcccct
gtcgtcggcttctttgatgcccacgtggagttcaacacgggctgggccgagcctgcgctc
gcgcggatccgggaggaccggcggcgcatcgtcctgccggccatcgacaacatcaagtac
gacacgttcgaggtgcagcaatacgccagcgctgcacatggctacaactgggggctctgg
tgcatgtacatcgtcccgccccaggactggctggaccgcggtgacgaggcggcgcccatc
aggacccctgccatgatcggctgctcattcgtggtggaccgggagtactttggggacatc
ggcctgctggacccaggcatggaggtgtacggcggcgagaacattgaactgggcatgagg
gtgtggcagtgcggcggcagcatggaggtcttgccctgctcacgcgtggcccacatcgag
cgcaccagaaagccctacagcggcgacatcgactactacgccaggcgcaatgctctgcgg
gccgccgaggtctggatggacggcttcaagtcccacgtgtacatggcctggaacatcccc
atgaccaacccaggcgtggacttcggggacgtgtccgagaggctggccctgcgccggaga
ctgaagtgccgcagcttcaagtggtacctggacaatgtgtatccggagatgagggtctac
aatgacaccctcacatacggagaggtgaggaacagcaaggccagtggctactgcctggac
cagggagctgaggacgatgaccaagccatcctctacccctgtcacgggatgtcctcccag
ctggtgaggtacagtgccgagggcctcctgcagctggggcccctggggtccacggccttc
ctgcccgactccaggtgtctggtagacagcgggggccgcacgcccaccctgaggaagtgc
gaggacgtggccaggcccacgcagcgactgtgggacttcacccagagtggccccatcgtg
agccgggacacgggccggtgcctggaactggagctgtcgaagggtgccagctttgggctg
cggctggtactgcagaggtgctcggggcagaagtggatgatcagaaactggatccggccc
gggcggcactga

DBGET integrated database retrieval system