KEGG   Tupaia chinensis (Chinese tree shrew): 102499034
Entry
102499034         CDS       T02978                                 

Gene name
SUFU
Definition
(RefSeq) SUFU negative regulator of hedgehog signaling
  KO
K06229  suppressor of fused
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04340  Hedgehog signaling pathway
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102499034 (SUFU)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102499034 (SUFU)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102499034 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU DUF5137
Other DBs
NCBI-GeneID: 102499034
NCBI-ProteinID: XP_014438819
LinkDB
Position
Un
AA seq 485 aa
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNVGSPSANIPEHWHYVSFGLSDLYGDSRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPVAGGPWLITDMRR
GETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRR
LSGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLTHDRAPSRKDSLESDSSTAAIPHE
LIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFAT
EEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPDKKLKVSILPDVVF
DSPLH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggagctgcggcctagcggcgcccccggccccaccgcgcccccagcccctggccct
actgcccccccggccttcgcttcgctctttcccccgggactgcacgccatctacggagag
tgccgccgcctttaccctgaccaaccaaacccgctccaggttaccgctatcgtcaagtac
tggttgggcggcccagatcccttggactatgttagcatgtacagaaatgtggggagccct
tctgccaacatccccgagcactggcactacgtcagcttcggcctgagcgatctctatggt
gacagcagagtccacgagtttacaggcacagatggacctagtggttttggctttgagttg
acatttcgtctgaaaagagaaacaggggagtctgccccaccaacgtggccagcagagctc
atgcaaggcctggcccgatacgtgttccagtcagagaacaccttctgcagtggggaccac
gtgtcctggcacagccctttggataacagtgagtcaagaatccagcacatgctgctgact
gaggacccgcagatgcaacctgtgcagacaccctttggggtggttaccttcctccagatt
gtgggcgtctgcaccgaggagctgcactcagcccagcagtggaacgggcagggcatcctg
gagctgctgcggacggtgcccgtcgccggcggcccctggctgataactgacatgcggagg
ggagagaccatatttgagatcgacccacatctgcaacaggagcgagttgacaaaggcata
gagacagacggctccaacctgagcggtgtcagtgccaaatgtgcctgggacgacctgagc
cgcccccccgaggatgacgaggacagccggagcatctgcatcggcacacagcctcggcgg
ctctctggcaaagacacagaacagatccgggagaccctgaggagaggacttgagatcaac
agcaaacctgtcctaccgccaatcaaccctcagcggcagaacggcctcacccatgaccgg
gccccaagccgcaaagacagcctggaaagtgacagctccacggccgctatcccccacgag
ctgatccgcacgcggcagctggagagtgtacatctcaagttcaaccaggagtcgggggcc
ctcattcctctctgcctacggggcaggctcctgcatggacggcactttacgtataaaagt
atcacaggtgacatggccatcacgttcgtctccacgggagtggaaggtgcctttgccact
gaggagcatccttatgcagctcatggaccctggttacaaattctgttgactgaagagttt
gtagaaaaaatgttggaagacttagaagatctgacttcgccagaggagttcaaacttccc
aaagagtacagctggcccgacaagaagctgaaagtctccatcctgcccgacgtggtgttt
gacagtccgctgcactag

DBGET integrated database retrieval system