KEGG   Tupaia chinensis (Chinese tree shrew): 102499824
Entry
102499824         CDS       T02978                                 

Gene name
SLC4A4
Definition
(RefSeq) solute carrier family 4 member 4
  KO
K13575  solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04964  Proximal tubule bicarbonate reclamation
tup04972  Pancreatic secretion
tup04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102499824 (SLC4A4)
   04976 Bile secretion
    102499824 (SLC4A4)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102499824 (SLC4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102499824 (SLC4A4)
Transporters [BR:tup02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   102499824 (SLC4A4)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 Fmp27_WPPW AP3D1
Other DBs
NCBI-GeneID: 102499824
NCBI-ProteinID: XP_006142964
LinkDB
Position
Un
AA seq 1094 aa
MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHREKKEKERI
SENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDG
QEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREAASLP
QLVEMIVDHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTN
PDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDTPFI
AFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKA
KDRHDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTP
HDGGHGGGGHGDCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLAT
VTNAITFGGLLGDATENMQGVLESFLGTAVSGAVFCLFAGQPLTILSSTGPVLVFERLLF
NFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDA
FKKMIKLASYYPINSDFKVGYNTHFSCVCVPPDPVNISISNDSILSPEDLPTSSSTGLYH
NATLDWEFLSKKECLKYGGKLVGNNCDFVPDITLMSFILFLGTYTSSMALKKFKTSRYFP
TTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVPPFGGNPWWV
YLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPW
YVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFI
PMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLC
LALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKK
KKKKGSLDSDNDDEKDRQHSLNATHHADKIPFLQSLGMPSPPRTPVKVVPQIRIELEPDD
NDYFWRSKGTETTL
NT seq 3285 nt   +upstreamnt  +downstreamnt
atggaggatgaagctgtcctggacagaggggcttccttccttaagcatgtgtgtgatgaa
gaagaagtagaaggccaccacaccatctacatcggggtccatgtgcccaagagctacagg
agaaggagacgtcacaagagaaaaacagggcacagagaaaagaaggagaaagagaggatc
tctgagaactactccgacaaatctgatgtggagaatgcagatgaatccagcagcagcatc
ctaaagcctctcatctctcctgcagccgaacgcatccgattcatcttgggagaggaggat
gacagcccagcaccccctcagctcttcaccgaactggacgagctgctggccgtggatggg
caggagatggagtggaaggagacagccaggtggattaagtttgaagaaaaagtggagcag
ggtggagagagatggagcaagccccatgtggccacattgtcccttcacagcttgtttgag
ctgaggacgtgtatggagaagggatccatcatgcttgaccgggaggccgcttctctccca
cagttggtggagatgattgtcgaccatcaaattgagacaggcctattgaagcctgacctt
aaggataaggtgacctacactttgctccggaaacaccgacatcaaaccaagaaatccaat
cttcggtcactggctgatattgggaagacggtctccagtgcaagcaggatgttcaccaac
cccgataacggtagcccagccatgacccataggaatctaacttcctccagcctgaatgac
atttctgataagccagagaaggaccagctgaagaataagttcatgaaaaaattgccacgt
gatgcagaagcgtctaacgtactcgttggggaggttgacttcctggacactcctttcatc
gcctttgtgcggctacagcaggctgtcatgctgggagcgctgactgaggtccctgtgccc
acaaggttcttgttcattctcttaggtccgaaggggaaagccaagtcctaccatgagatc
ggcagagccattgccacgctgatgtctgatgaggtattccatgacattgcttataaagca
aaagacaggcatgatctgatcgctggcattgatgagttcttagatgaagtcattgtcctc
ccacctggagaatgggacccggcaatcaggatagagcctcctaagagccttccatcatct
gacaaaagaaagaatatgtactcaggaggggagaatgttcagatgaatggggacacaccc
catgatggaggacatggaggaggaggacatggggactgtgaagaactgcagcgaactgga
cggttctgtggtggactaattaaggacataaagaggaaagcaccattttttgccagtgac
ttttatgacgctttaaatattcaggctctttcagcaattctcttcatttatctggcaact
gtaactaatgctatcacttttggaggactgcttggggatgccaccgaaaacatgcagggc
gtgttggagagtttcctgggcactgctgtctctggagctgtcttttgcctttttgctggt
caacctctcactatcttgagcagtacaggacccgtcttagtttttgagagacttctattt
aattttagcaaggaccataattttgactatttggaatttcgcctttggattggcctgtgg
tcagcgttcctgtgtctcattctggtagccactgatgccagcttcttggttcagtacttc
actcgtttcacagaagagggcttctcgtctctcattagcttcatctttatctatgatgct
ttcaagaagatgatcaagctagcaagttactaccccatcaactctgacttcaaagtgggc
tacaacactcatttttcctgtgtctgtgtaccacccgacccagttaacatctcaatatct
aatgacagtatactgtctccagaggatttgccaactagttcttctactggcttgtaccat
aatgctactcttgactgggaatttttatcgaagaaggagtgcttgaaatatggaggaaag
ctcgtggggaacaactgtgattttgttcctgatatcacacttatgtctttcatcctcttc
ttgggcacctatacctcttctatggctctgaaaaaattcaaaactagtcgttattttcca
accacagcaagaaaactgatcagtgactttgccattatcttgtccattctcatcttttgt
gtaatagatgccctagtaggtgtggacactccaaaactaattgtgccaagtgaattcaag
ccaacaagtccaaaccgaggttggtttgttccaccatttggaggaaatccctggtgggta
taccttgctgctgctatccctgctttgttggtcaccattctgatttttatggaccagcaa
atcacagctgtgattgtaaacagaaaagaacataagctcaagaaaggagctgggtatcac
ttggatcttttctgggtggctatcctcatggtggtatgctctttcatggctcttccgtgg
tacgtggctgctaccgtcatctccattgctcacatcgacagtttgaagatggaaacagag
acttccgcacccggagaacagccgaagtttctaggagtgagggaacaaagagtcaccgga
actcttgtgtttattctgactggtctgtcagtctttatggctcccatcttgaagtttatt
cccatgcctgtactctatggggttttcctgtacatgggagtagcatccctgaatggtgtg
cagttcatggatcgcctgaagctgcttctgatgcctctgaagcatcagcctgacttcatc
tacctgcgtcacgtccccctgcgcagagtccacctgttcaccttcctgcaggtcttgtgt
ctggccctgctctggatcctcaaatcaaccgtggctgctataatttttccagtcatgatc
ttggcacttgtagctgtcagaaaaggcatggactacctcttctcccagcatgacctcagc
ttcctcgatgatgtcattccagaaaaggacaagaaaaagaaggaggatgagaagaaaaag
aaaaagaagaaggggagtctcgacagtgacaatgacgatgagaaagatcgtcaacattcc
ttgaacgccacacatcatgctgataaaattcctttccttcagtcactgggtatgccaagt
cctcctagaactccagtaaaagttgtgcctcaaattagaatagaacttgagcctgacgac
aatgattatttctggaggagcaagggaacagaaactacattgtaa

DBGET integrated database retrieval system