KEGG   Tupaia chinensis (Chinese tree shrew): 102499950
Entry
102499950         CDS       T02978                                 

Gene name
BBC3
Definition
(RefSeq) BCL2 binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01524  Platinum drug resistance
tup04115  p53 signaling pathway
tup04210  Apoptosis
tup04215  Apoptosis - multiple species
tup04390  Hippo signaling pathway
tup05016  Huntington disease
tup05162  Measles
tup05200  Pathways in cancer
tup05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102499950 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102499950 (BBC3)
   04215 Apoptosis - multiple species
    102499950 (BBC3)
   04115 p53 signaling pathway
    102499950 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102499950 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102499950 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102499950 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    102499950 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102499950 (BBC3)
SSDB
Motif
Pfam: PUMA Hepatitis_core DUF3886
Other DBs
NCBI-GeneID: 102499950
NCBI-ProteinID: XP_014438161
LinkDB
Position
Un
AA seq 135 aa
LLPAAHLCAPTAALGGSRWPGGPRSRPRGPRPDGPQPSISPAEQHLESPVPSAPGALAGG
PTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLILGL
LPLPRGHRAPEMEPN
NT seq 408 nt   +upstreamnt  +downstreamnt
ctgctgcctgctgcccacctctgcgcccccaccgcagccctggggggctctcgctggcct
ggggggccccgcagccggccccgaggcccgcgaccggacggtcctcagccatctatctcg
ccagcggagcagcacctggagtctcctgtacctagtgccccgggggccctggcgggcggt
cccacccaggcggccccgggagtccggggggaggaggagcagtgggcccgagagatcggg
gcccagctgcggcggatggcggacgacctcaacgcgcagtacgagcggcggagacaagaa
gagcagcaacggcaccgcccctcgccctggagggtcctgtacaatcttatcctgggactc
ctgcccttacccaggggccacagagcccccgagatggagcccaattag

DBGET integrated database retrieval system