Tupaia chinensis (Chinese tree shrew): 102500069 Help Entry 102500069         CDS       T02978                                  Gene name KRAS Definition (RefSeq) KRAS proto-oncogene, GTPase   KO K07827   GTPase KRas Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup01521   EGFR tyrosine kinase inhibitor resistance tup01522   Endocrine resistance tup04010   MAPK signaling pathway tup04012   ErbB signaling pathway tup04014   Ras signaling pathway tup04015   Rap1 signaling pathway tup04062   Chemokine signaling pathway tup04068   FoxO signaling pathway tup04071   Sphingolipid signaling pathway tup04072   Phospholipase D signaling pathway tup04137   Mitophagy - animal tup04140   Autophagy - animal tup04150   mTOR signaling pathway tup04151   PI3K-Akt signaling pathway tup04210   Apoptosis tup04211   Longevity regulating pathway tup04213   Longevity regulating pathway - multiple species tup04218   Cellular senescence tup04360   Axon guidance tup04370   VEGF signaling pathway tup04371   Apelin signaling pathway tup04540   Gap junction tup04550   Signaling pathways regulating pluripotency of stem cells tup04625   C-type lectin receptor signaling pathway tup04650   Natural killer cell mediated cytotoxicity tup04660   T cell receptor signaling pathway tup04662   B cell receptor signaling pathway tup04664   Fc epsilon RI signaling pathway tup04714   Thermogenesis tup04720   Long-term potentiation tup04722   Neurotrophin signaling pathway tup04725   Cholinergic synapse tup04726   Serotonergic synapse tup04730   Long-term depression tup04810   Regulation of actin cytoskeleton tup04910   Insulin signaling pathway tup04912   GnRH signaling pathway tup04914   Progesterone-mediated oocyte maturation tup04915   Estrogen signaling pathway tup04916   Melanogenesis tup04917   Prolactin signaling pathway tup04919   Thyroid hormone signaling pathway tup04921   Oxytocin signaling pathway tup04926   Relaxin signaling pathway tup04929   GnRH secretion tup04933   AGE-RAGE signaling pathway in diabetic complications tup04935   Growth hormone synthesis, secretion and action tup04960   Aldosterone-regulated sodium reabsorption tup05010   Alzheimer disease tup05022   Pathways of neurodegeneration - multiple diseases tup05034   Alcoholism tup05160   Hepatitis C tup05161   Hepatitis B tup05163   Human cytomegalovirus infection tup05165   Human papillomavirus infection tup05166   Human T-cell leukemia virus 1 infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer tup05203   Viral carcinogenesis tup05205   Proteoglycans in cancer tup05206   MicroRNAs in cancer tup05210   Colorectal cancer tup05211   Renal cell carcinoma tup05212   Pancreatic cancer tup05213   Endometrial cancer tup05214   Glioma tup05215   Prostate cancer tup05216   Thyroid cancer tup05218   Melanoma tup05219   Bladder cancer tup05220   Chronic myeloid leukemia tup05221   Acute myeloid leukemia tup05223   Non-small cell lung cancer tup05224   Breast cancer tup05225   Hepatocellular carcinoma tup05226   Gastric cancer tup05230   Central carbon metabolism in cancer tup05231   Choline metabolism in cancer tup05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102500069 (KRAS)    04012 ErbB signaling pathway     102500069 (KRAS)    04014 Ras signaling pathway     102500069 (KRAS)    04015 Rap1 signaling pathway     102500069 (KRAS)    04370 VEGF signaling pathway     102500069 (KRAS)    04371 Apelin signaling pathway     102500069 (KRAS)    04068 FoxO signaling pathway     102500069 (KRAS)    04072 Phospholipase D signaling pathway     102500069 (KRAS)    04071 Sphingolipid signaling pathway     102500069 (KRAS)    04151 PI3K-Akt signaling pathway     102500069 (KRAS)    04150 mTOR signaling pathway     102500069 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102500069 (KRAS)    04137 Mitophagy - animal     102500069 (KRAS)   09143 Cell growth and death    04210 Apoptosis     102500069 (KRAS)    04218 Cellular senescence     102500069 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102500069 (KRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102500069 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102500069 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102500069 (KRAS)    04650 Natural killer cell mediated cytotoxicity     102500069 (KRAS)    04660 T cell receptor signaling pathway     102500069 (KRAS)    04662 B cell receptor signaling pathway     102500069 (KRAS)    04664 Fc epsilon RI signaling pathway     102500069 (KRAS)    04062 Chemokine signaling pathway     102500069 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102500069 (KRAS)    04929 GnRH secretion     102500069 (KRAS)    04912 GnRH signaling pathway     102500069 (KRAS)    04915 Estrogen signaling pathway     102500069 (KRAS)    04914 Progesterone-mediated oocyte maturation     102500069 (KRAS)    04917 Prolactin signaling pathway     102500069 (KRAS)    04921 Oxytocin signaling pathway     102500069 (KRAS)    04926 Relaxin signaling pathway     102500069 (KRAS)    04935 Growth hormone synthesis, secretion and action     102500069 (KRAS)    04919 Thyroid hormone signaling pathway     102500069 (KRAS)    04916 Melanogenesis     102500069 (KRAS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102500069 (KRAS)   09156 Nervous system    04725 Cholinergic synapse     102500069 (KRAS)    04726 Serotonergic synapse     102500069 (KRAS)    04720 Long-term potentiation     102500069 (KRAS)    04730 Long-term depression     102500069 (KRAS)    04722 Neurotrophin signaling pathway     102500069 (KRAS)   09158 Development and regeneration    04360 Axon guidance     102500069 (KRAS)   09149 Aging    04211 Longevity regulating pathway     102500069 (KRAS)    04213 Longevity regulating pathway - multiple species     102500069 (KRAS)   09159 Environmental adaptation    04714 Thermogenesis     102500069 (KRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102500069 (KRAS)    05206 MicroRNAs in cancer     102500069 (KRAS)    05205 Proteoglycans in cancer     102500069 (KRAS)    05203 Viral carcinogenesis     102500069 (KRAS)    05230 Central carbon metabolism in cancer     102500069 (KRAS)    05231 Choline metabolism in cancer     102500069 (KRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102500069 (KRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102500069 (KRAS)    05212 Pancreatic cancer     102500069 (KRAS)    05225 Hepatocellular carcinoma     102500069 (KRAS)    05226 Gastric cancer     102500069 (KRAS)    05214 Glioma     102500069 (KRAS)    05216 Thyroid cancer     102500069 (KRAS)    05221 Acute myeloid leukemia     102500069 (KRAS)    05220 Chronic myeloid leukemia     102500069 (KRAS)    05218 Melanoma     102500069 (KRAS)    05211 Renal cell carcinoma     102500069 (KRAS)    05219 Bladder cancer     102500069 (KRAS)    05215 Prostate cancer     102500069 (KRAS)    05213 Endometrial cancer     102500069 (KRAS)    05224 Breast cancer     102500069 (KRAS)    05223 Non-small cell lung cancer     102500069 (KRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102500069 (KRAS)    05022 Pathways of neurodegeneration - multiple diseases     102500069 (KRAS)   09165 Substance dependence    05034 Alcoholism     102500069 (KRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102500069 (KRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102500069 (KRAS)    05170 Human immunodeficiency virus 1 infection     102500069 (KRAS)    05161 Hepatitis B     102500069 (KRAS)    05160 Hepatitis C     102500069 (KRAS)    05163 Human cytomegalovirus infection     102500069 (KRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102500069 (KRAS)    05165 Human papillomavirus infection     102500069 (KRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102500069 (KRAS)    01522 Endocrine resistance     102500069 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tup04131]     102500069 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tup04031]     102500069 (KRAS) Membrane trafficking [BR:tup04131]  Endocytosis   Macropinocytosis    Ras GTPases     102500069 (KRAS) GTP-binding proteins [BR:tup04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102500069 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N Gtr1_RagA ATP_bind_1 Septin DUF1413 NB-ARC AAA_25 Motif Other DBs NCBI-GeneID:  102500069 NCBI-ProteinID:  XP_006140353 LinkDB All DBs Position Un AA seq 241 aa AA seqDB search MARGGGRGGGGFSGGCGGGGGGCGGGCLASSEGGGGGQRLGGSQVRERGLLKMTEYKLVV VGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMR DQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTK QAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKIISKEEKTPGCVKIKKCII M NT seq 726 nt NT seq  +upstreamnt  +downstreamnt atggcgcgaggcggcggccgcggcggcggaggctttagcggcggctgtggcggcggcggc ggcggctgtggcggcggctgcttggccagctctgaaggcggcggcgggggccagaggctc ggcggctcccaggtgcgggagagaggcctgctgaaaatgactgaatataaacttgtggta gttggagctggtggcgtaggcaagagtgccttgacgatacagcttattcagaatcacttt gtggatgaatatgatcctacaatagaggattcctacaggaaacaagtagtaattgatgga gaaacctgtctcttggatattctcgacacagcaggtcaagaggagtacagtgcaatgagg gaccagtacatgaggactggggagggctttctttgtgtatttgccataaataatactaaa tcatttgaagatattcaccattatagagaacagattaaaagagttaaagactctgaagat gtacccatggtcctcgtaggaaataaatgtgatttgccttctagaacagtagatacaaaa caggctcaggacttagcaagaagttatggaattcctttcattgaaacatcagcaaagaca agacagagagtggaggatgctttttatacattggtgagagagatccgacaatacagattg aaaataatcagcaaagaagaaaagactcctggctgtgtgaaaattaaaaaatgcattata atgtaa

DBGET integrated database retrieval system