KEGG   Tupaia chinensis (Chinese tree shrew): 102500485
Entry
102500485         CDS       T02978                                 

Gene name
BCL2L11
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04068  FoxO signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04215  Apoptosis - multiple species
tup04932  Non-alcoholic fatty liver disease
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102500485 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    102500485 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102500485 (BCL2L11)
   04215 Apoptosis - multiple species
    102500485 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102500485 (BCL2L11)
   05206 MicroRNAs in cancer
    102500485 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102500485 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102500485 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102500485 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102500485 (BCL2L11)
SSDB
Motif
Pfam: Bim_N Bclx_interact
Other DBs
NCBI-GeneID: 102500485
NCBI-ProteinID: XP_006156696
LinkDB
Position
Un
AA seq 272 aa
MGPERGTRPAACNRCICARSCAPALYLILGNQSPLGVSALFKKKDQMAKQPSDVSSECDR
EGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGQGEGDRCPQGSPQGPLAPPASPGPFATR
SPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQ
FQAEPADLRPEIWIAQELRRIGDEFNAYYPRRVMMFLFYPFLLTPLPAVLIKKVPSNNYI
LTRNERCHLCVTFHSFFFHFPFALWLNLSDEN
NT seq 819 nt   +upstreamnt  +downstreamnt
atggggccggagcggggaacgcggccagccgcctgcaatcgctgcatctgcgcccgctcc
tgtgctccagcgctgtatctgatcctgggaaaccagagcccactgggagtttctgcctta
ttcaaaaaaaaagaccaaatggcaaagcaaccttccgatgtaagttctgagtgtgacaga
gaaggcaggcaattgcagcctgcagagaggcccccccagctcaggcctggggcccctacc
tccctacagacagagccgcaaggtaatcctgaaggccaaggcgaaggggaccgctgcccc
caaggcagccctcagggcccgttggccccaccggccagccctggcccttttgctaccaga
tccccacttttcatctttgtgagaagatcctccctgctgtctcgatcctccagtgggtat
ttctcttttgacacagacaggagcccggcacccatgagttgtgacaaatcaacacaaacc
ccaagtcctccttgccaggccttcaaccattatctcagtgcaatggcttccatgaggcag
tttcaggccgaacctgcagatttgcgtccggagatatggatcgcgcaagagttgcggcgt
attggagacgagtttaatgcatattacccaaggagggtaatgatgtttcttttttaccct
tttctcctcacccccctccctgctgtgttaataaaaaaggtgcctagtaataactacata
ctaactagaaacgaaaggtgtcacctgtgtgtgacctttcattctttctttttccatttc
ccatttgctttatggctgaatttaagcgatgaaaattaa

DBGET integrated database retrieval system