KEGG   Tupaia chinensis (Chinese tree shrew): 102500494
Entry
102500494         CDS       T02978                                 

Gene name
KCNQ1
Definition
(RefSeq) potassium voltage-gated channel subfamily Q member 1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04725  Cholinergic synapse
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102500494 (KCNQ1)
  09154 Digestive system
   04971 Gastric acid secretion
    102500494 (KCNQ1)
   04972 Pancreatic secretion
    102500494 (KCNQ1)
   04974 Protein digestion and absorption
    102500494 (KCNQ1)
  09156 Nervous system
   04725 Cholinergic synapse
    102500494 (KCNQ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102500494 (KCNQ1)
Ion channels [BR:tup04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   102500494 (KCNQ1)
SSDB
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2 WDCP
Other DBs
NCBI-GeneID: 102500494
NCBI-ProteinID: XP_006141226
LinkDB
Position
Un
AA seq 641 aa
MQAYLRFMNLTDLNPQGKYAQHGVGALQPRPALLSNPGLSVPPFVIGVALEGQTELGRVR
APGRWQLGVGSTWVGGCPVGWAAPCADCRVLSSCSFLIVLVCLIFSVLSTIEQYVTLATG
TLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLIVVVASMVVLC
VGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLI
FSSYFVYLAEKDAVNESGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSV
FAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAPSLIQTAWRCYAAENPDSSTWKI
YVRKPSRNHTLLSPSPKPKKSVMVKKKKFKLDKDNGVSPGEKMLTIPHITCXXXXRKPDH
FSVDGYDSSVRKSPTLLEVNTTHFLRTNSFAEDLDLEGETLLVPITHVSQLREHHRATIK
VIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFVS
VSEKSKDRGSNTIGARLNRVEDKVTQLDQRLGLITDMLHQLLALHHGGPPSSGPPSGGGP
QVAQPCSDSSSPINPKLFLPSNSLPTYEQLTVPRRGPDEGS
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgcaggcgtatttgaggttcatgaacctcacagacctcaatcctcaagggaaatatgca
caacatggggtgggggctctgcagcccaggccagccctactttctaatcctggcctctca
gtgccaccatttgtcattggtgtagcccttgagggccaaactgagctagggagggtaaga
gcccccggccgatggcagctgggtgttggcagcacctgggtgggtgggtgccctgtcggg
tgggcagccccgtgtgctgactgccgtgtcctctcatcttgcagcttcctcatcgtcctg
gtctgcctcatcttcagcgtgctgtccaccatcgagcagtatgtcactctggccacgggg
acactcttctggatggagatcgtcctggtggtgttcttcgggacggagtacgtggtccgc
ctctggtcagctggctgccgcagcaagtacgtgggcatctgggggcggctgcgctttgcc
cggaagcccatttccatcattgacctcattgtagttgtggcctccatggtagtcctctgc
gtgggctccaaagggcaggtgttcgccacatcggccatcaggggcatccgcttcctccag
atcctgcggatgctgcacgtcgaccgccagggaggcacctggaggctgctgggctccgtg
gtcttcatccaccgccaggagctgatcaccactctgtacatcggcttcttgggcctcatc
ttctcctcatacttcgtgtacctggctgagaaggacgcggtgaacgagtctggccgcgtc
gagtttggcagctatgcggatgcactgtggtggggggtggtcacagtcaccaccattggc
tacggggacaaagtaccccagacgtgggtcggaaagaccattgcctcctgcttctctgtc
ttcgccatctccttctttgcactcccagcggggattctcggctccgggtttgccctgaag
gtgcagcagaagcagaggcagaagcacttcaaccggcagatcccagcggcaccctcactc
atccagactgcgtggaggtgctatgctgctgagaaccccgactcctccacctggaagatc
tatgttcggaaaccctcccggaaccacactctgctctcgcccagccccaagcccaagaag
tctgtcatggtaaagaaaaaaaagttcaagctggacaaggacaacggagtgagtcctgga
gagaagatgctcacaatcccccacatcacgtgcnnnnnnnnnnnncggaaaccagaccac
ttctctgttgatggctatgacagctctgtgaggaagagccccacgctgctggaagtgaat
acgacccacttcctgagaaccaacagcttcgctgaggacctggacctggaaggggagacg
ctcctggttcccatcacacacgtctcacagctgcgagagcaccaccgagccaccatcaag
gtcattcggcgaatgcagtactttgtggccaagaagaaattccagcaagcacggaagcct
tacgacgtgcgggacgtcattgagcagtactctcagggccacctcaacctcatggtgcgc
atcaaagagctgcagaggaggctggaccagtccatcgggaagccctccctgttcgtctct
gtctcagaaaagagcaaggaccgcggcagcaataccatcggcgcccgcctgaaccgggtg
gaggacaaggtgacgcagctggaccagaggctggggctcatcacggacatgctccaccag
ctgctggccctgcaccatggcgggcccccgagcagtggcccccccagtgggggtgggccc
caagtagcccagccctgcagtgacagcagcagccccataaaccccaagctcttcctgccc
agcaactccctgcccacctatgagcagctgaccgtgccccggaggggccctgatgagggg
tcctga

DBGET integrated database retrieval system