KEGG   Tupaia chinensis (Chinese tree shrew): 102500620Help
Entry
102500620         CDS       T02978                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 1A-like
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04024  cAMP signaling pathway
tup04080  Neuroactive ligand-receptor interaction
tup04726  Serotonergic synapse
tup04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102500620
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102500620
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    102500620
  09157 Sensory system
   04742 Taste transduction
    102500620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tup04030]
    102500620
G protein-coupled receptors [BR:tup04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    102500620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 102500620
NCBI-ProteinID: XP_014446476
LinkDB All DBs
Position
Un
AA seq 418 aa AA seqDB search
MDVLSASQSNNTTSSQGPFETGGNATGISDVTLSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTXKKGGDTRLGA
SSAPQPKKSVNGQPESRDWGPGMENRAGGVPCANGAVRQGDDGAALEVIEVHRVGNSKEH
LPLPSEGGAIPCVPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIV
ALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPIIYAYFNKDFQNAFKKIIKCKFCRR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgctcagcgctagccagagcaacaacaccacatcgtcccagggtccctttgaa
acgggtggcaacgctactggcatctccgacgtgaccctcagctaccaagtgatcacctct
ttgctgctgggcacgctcatcttctgcgcggtgctgggcaatgcgtgcgtggtggctgcc
atcgccctggagcgctccctgcagaacgtggccaactatctcataggttctttggcggtc
accgacctcatggtgtcggtgctggtgctgcccatggccgcgctgtaccaggtgctcaac
aagtggaccctgggccaggtcacctgcgacctgttcattgcccttgacgtgctgtgctgc
acctcatccattctgcacctgtgcgccatcgcgctggacaggtactgggccatcacggac
cccatcgactacgtgaacaagaggacgcccaggcgcgccgctgcgctcatctcgctcact
tggcttattggcttcctcatctccatcccgcccatgctgggctggcgcacccctgaagac
cgctcagaccccgacgcctgcaccatcagcaaagaccacggctacactatctactccact
ttcggcgctttctatatcccactgctgctcatgctggttctctatgggcgcatcttccga
gccgcgcgcttccgcatccgcaagacanngaagaagggtggggatactcgtctgggagca
tcctcagcccctcagcccaagaagagcgtgaatggacagccagagagcagggactggggg
ccgggtatggagaacagagctggcggtgtcccgtgcgccaacggtgcggtgaggcagggc
gacgatggcgccgccctggaggtgatcgaggtgcaccgagtgggcaactccaaagagcat
ctgcctctgcccagcgagggcggtgctatcccctgcgtccctgcctccttcgagaggaaa
aatgagcgcaacgcagaggccaagcgcaagatggccctggcccgcgagaggaaaactgtg
aagactctgggcatcattatgggcaccttcatcctctgctggctgccattcttcatcgtg
gccctagtcttgcccttctgcgagagcagctgccacatgcccaccctactgggcgccata
atcaactggctgggctactccaactctctgctcaaccctattatttacgcctacttcaac
aaagacttccaaaacgcgtttaagaagatcatcaagtgcaagttctgtcgccgatga

DBGET integrated database retrieval system