KEGG   Tupaia chinensis (Chinese tree shrew): 102500820
Entry
102500820         CDS       T02978                                 

Gene name
CEL
Definition
(RefSeq) carboxyl ester lipase
  KO
K12298  bile salt-stimulated lipase [EC:3.1.1.3 3.1.1.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00100  Steroid biosynthesis
tup00561  Glycerolipid metabolism
tup01100  Metabolic pathways
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Module
tup_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102500820 (CEL)
   00561 Glycerolipid metabolism
    102500820 (CEL)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102500820 (CEL)
   04975 Fat digestion and absorption
    102500820 (CEL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102500820 (CEL)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     102500820 (CEL)
    3.1.1.13  sterol esterase
     102500820 (CEL)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102500820 (CEL)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 Mucin-like Say1_Mug180
Other DBs
NCBI-GeneID: 102500820
NCBI-ProteinID: XP_006164405
LinkDB
Position
Un
AA seq 663 aa
MGRLELAVLGLTCCLAVVRAAKLGAVYTEGGFVEGVNKKLGLLGDSIDVFKGIPFAAPPK
PLENPERHPGWQGGTGWALGGPGTWGVKGLQGRQMDRRAVRLHPAQGGAGTGKLSERQQM
AWVAQELQGRCQEGLAGQSGDRALAPPTLLGHRLCRPGLCWGLSVVEDTHPCTAWHPLCR
GPMKALPCLAPGNYGLRDQHMAISWVKRNIAAFGGDPDNITIFGESAGGASVSLQTLSPY
NKGLIRRAISQSGVALSPWVIQKNPLFWAKRIAEKVGCPVDDTARMAKCMKVTDPRALTL
AYKMPLAGMEYPMLHYLGFVPVIDGDFIPDDPVNLYANAADIDYIAGTNNMDGHIFASID
VPAINKDKQDVTEEDFYKLVSGLTITKGSEGAKSAFGIYTESWAQDPSQETRKKTVVDFE
TDILFLVPTEIALAQHRANAKSAKTYTYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFA
TPLGYRAQDRTVSKAMIAYWTNFAKTGDPNMGHSAVPTHWDPYTRENGNYLEINKKMDSS
SMKQHLRTNFLRYWTLTYQALPTVTDQGAAPVPPTDDSEAAPVPPTDDSEAAPSPPADDS
EAAPAPPADDSEGAPMPKVFEFCARILLEATVFTHSSAEESKMALCLEAGGKGEQQSSHR
TQQ
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggggcgcctggagctggccgtcttgggcctcacctgctgcttggcagtggtgagggcg
gcgaagctgggcgcagtgtacacggaaggtggtttcgtggaaggcgtcaacaagaagctc
ggcctcttgggcgactccattgatgtcttcaaagggatccccttcgccgccccacccaag
cccctggagaaccccgagcgacaccccggctggcaaggtgggactgggtgggctctgggt
ggccctgggacatggggagtaaaagggctgcagggcagacagatggacaggcgggcagtt
agactccaccctgcccaagggggagcagggacagggaagctgagtgagaggcagcagatg
gcatgggtggcacaggagctgcagggcaggtgccaggagggactggcagggcagagcgga
gacagggccctggcccctcccaccctcctgggacaccgcctttgccgtcctgggctctgc
tggggtctcagcgtagttgaggacacccacccctgcactgcctggcacccgctgtgccgg
ggtccgatgaaggccctcccctgcctggccccaggtaactacggactacgggaccagcac
atggccatctcctgggtgaagaggaacatcgcggccttcggcggggaccccgacaacatc
accatctttggggagtcagctggaggcgccagcgtgtctctgcagaccctctccccctac
aacaagggcctcatccgacgagccatcagccagagcggtgtggcgctgagcccctgggtc
atccagaagaaccccctcttctgggccaaaaggattgccgagaaggtgggctgccccgtg
gacgacaccgccagaatggccaagtgcatgaaggtcaccgacccgcgcgccctgacgctg
gcctacaagatgcccctggcgggcatggagtaccccatgctgcactatctgggcttcgtc
cctgtcatcgatggagacttcatccctgatgaccctgtcaacctgtacgccaacgccgcc
gacatcgactacatagcgggcaccaacaacatggacggccacatcttcgcaagcattgac
gtgccagccatcaacaaggacaagcaggatgtcacggaggaggacttctacaagctggtc
agcgggctcaccatcaccaagggctccgagggcgccaagtctgcctttggcatctacacc
gagtcctgggcccaggacccatcccaggagaccaggaagaagaccgtggtggacttcgag
actgacatcctcttcctggtgcccacggagatcgccctggcccagcacagggccaacgcc
aagagtgccaagacctacacctacctgttttcccacccctctcggatgcccgtctacccc
aagtgggtgggggccgaccacgccgacgacatccagtacgtcttcgggaaacccttcgcc
acccccctgggctaccgcgcccaagaccggacagtctcgaaggccatgattgcctactgg
accaacttcgccaagactggggaccccaacatgggccactccgccgtgcccacgcactgg
gacccctacaccagggagaacggcaactacctggagatcaacaagaagatggacagcagc
tccatgaagcagcacctgaggaccaacttcctgcggtactggaccctgacctaccaggca
ctgcccaccgtgaccgaccagggggccgcccccgtgccccccacggacgactccgaggcc
gcccccgtgcccccaacggatgactccgaggccgccccttcaccccctgcggacgactcc
gaggccgcccctgcgcccccagcggacgactctgagggggctccgatgccgaaggtcttt
gagttctgcgccaggatcctcctggaagcgacagtcttcactcactcctccgctgaagaa
agcaagatggcgctctgcctggaggccggaggcaagggggagcagcagtcgagccaccga
acacagcagtag

DBGET integrated database retrieval system