KEGG   Tupaia chinensis (Chinese tree shrew): 102501064Help
Entry
102501064         CDS       T02978                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102501064 (TGM1)
Enzymes [BR:tup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102501064 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102501064
NCBI-ProteinID: XP_006144632
UniProt: L9L262
LinkDB All DBs
Position
Un
AA seq 808 aa AA seqDB search
MMDGPRSDVGRWGGNPWQPPSTPSPEPEPEPDRRSRGGGRSFWARCCGCCSCRNEVDDDR
RPEPSGSRRPDSSRGSDSPRRPGSGGSAVNAAGDGTIREGMLVVTGVDLLSSRSDQNRRE
HHTDEFEYEELILRRGQPFRMVLFLSRPYESSDRITLELFIGNNPEVGKGTHVVIPVGKG
GSGGWKAQVTKADGQNLNLRVHTSPNAIIGKFQFTVRTQSEAGEFQLPLDPRNEIYILFN
AWCPEDIVYVEHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRR
GMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRT
GSSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLN
HDSVWNFHVWNDCWMKRPDLPSGFNGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMK
YDTPFIFAQVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAINSNMREDITHLYKHPE
GSEAERKAVETAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQDLSVSVLLTNRSSSRR
TVKLHLYLSVTFYTGVTGTIFKETKKEVVLAPGASDRVAMPVAYKEYRPHLVDQGAMLLN
VSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRL
EGSGLQRSKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAP
APGGGGFLNAREDSHSGETIPMASRGGA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgatggacggtcctcgttcggacgtgggccgctggggggggaacccctggcagccccct
agcacaccttctccagagccagagccagagccagacagacgttctcgaggaggaggccga
tccttctgggctcgctgctgtggctgctgctcgtgccggaatgaagtggatgatgaccgg
aggcctgagccctctgggagccggagacctgactcttctcggggctcagactctcctcgc
aggcccggctcggggggcagtgctgtgaatgcagcgggagacggcactatccgagagggt
atgctggtggtgaccggtgtggatttgctgagctcgcgctcagaccagaaccgccgagaa
caccacacggacgagttcgagtatgaggagctgattttgcgccgcgggcagcctttccgc
atggtcctcttcctgtcccggccctatgagtcctccgatcggatcaccttggagctgttc
attggaaacaaccccgaggtgggcaagggcacccacgtggtcatcccagtgggcaagggg
ggcagtggaggctggaaggcccaagtgaccaaagctgatgggcagaacctgaacctgcgg
gtccacacctcccccaatgccatcattggcaagtttcagttcacggtccgcacgcagtca
gaggcaggggagttccagctgccccttgacccccgcaatgagatctatatcctcttcaat
gcttggtgcccagaggacatcgtgtatgtggagcacgaggactggaggcaggagtatgtg
ctgaatgagtctgggagaatttactatgggaccgaagcacagattggagagcggacctgg
aactatggccagtttgaccacggggtgctggatgcctgtctgtacatcctggaccggcgg
gggatgccatatggaggccgcggggacccagtcagtgtctcccgggtcatctctgccatg
gtgaactccctggatgacaatggagtcctgattgggaactggtctggcgattactcccga
ggcaccaacccatcagcatgggtgggcagcgtggagatcctgctcagctatctacggacc
ggctcttccgtcccctatggccaatgctgggtctttgctggtgtgaccaccacagtactg
cgctgcctgggtctggccacccggacagtcaccaacttcaactctgcacatgacactgac
acgtccctcacgatggacatctactttgatgagaacatgaagccgctcgagcacctgaac
catgattctgtttggaactttcacgtgtggaatgactgctggatgaagcggccggatctg
ccctccggcttcaatggctggcaggttgtggacgccacgccccaggagaccagcagcggc
atcttctgctgtggcccctgctctgtggagtccatcaagaatggcctggtgtacatgaag
tatgacacacccttcatttttgctcaagtgaatagtgacaaggtatactggcaaaggcag
gatgatggcagcttcaagattgtgtacgtggaggagaaggccattggcacactcatcgtc
acaaaggccatcaactccaacatgcgagaggacatcactcacctctataagcacccagaa
ggctcagaagcagagcggaaggccgtggagacggcagctgcccatggcagcaaacccaat
gtgtatgccacacgggactcggctgaggatgtggccatgcaggtggaggcacaggacgca
gtgatggggcaggacctgtcagtctctgtgctgctgaccaatcgcagcagcagccgccgc
actgtgaagctgcacctctacctctcagtcactttctacaccggtgtcactgggaccatc
ttcaaggagaccaagaaggaagttgtgctagcaccaggagcctcggaccgtgtggccatg
cctgtagcctacaaggaataccggccccacctcgtggaccagggggccatgctgctcaac
gtctcaggccacgtcaaggagagtgggcaggtgctagccaagcagcataccttccgtctg
cgcacccccgatctgtccctcaccttactgggagcagcagtggttggccaggaatgtgaa
gtccagatcgtcttcaagaaccccctgcctgtcaccctcaccaacgtcgtcttcaggctc
gagggctctgggttacagagatccaagatcctcaatgttggggacatcggaggcaatgag
acagtgacactgcgtcagacatttgtgcctgtgcgaccaggcccccgccagcttatcgcc
agcttggacagcccacagctctcccaggtgcatggtgtcatccaggtggacgtggctcca
gcccccggaggtggaggattcttaaatgctagagaggacagtcactcaggggagaccatt
cctatggcatctcgaggcggagcttag

DBGET integrated database retrieval system