KEGG   Tupaia chinensis (Chinese tree shrew): 102501147
Entry
102501147         CDS       T02978                                 

Gene name
SLC9A1
Definition
(RefSeq) solute carrier family 9 member A1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04371  Apelin signaling pathway
tup04810  Regulation of actin cytoskeleton
tup04919  Thyroid hormone signaling pathway
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102501147 (SLC9A1)
   04024 cAMP signaling pathway
    102501147 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102501147 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102501147 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102501147 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    102501147 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    102501147 (SLC9A1)
   04971 Gastric acid secretion
    102501147 (SLC9A1)
   04972 Pancreatic secretion
    102501147 (SLC9A1)
   04976 Bile secretion
    102501147 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102501147 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102501147 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102501147 (SLC9A1)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102501147 (SLC9A1)
Transporters [BR:tup02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   102501147 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 102501147
NCBI-ProteinID: XP_006155377
LinkDB
Position
Un
AA seq 815 aa
MLLGAGGCGLFPPRSLPSLLVVVALVGLLPVLRSHGLQPSPTASTIRGSEPPRGRSIGDV
TTAPPEVTPESHPVNHSVPDHGMKHRKAFPVLGIDYTHVRRPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDSLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYDHVGIVDIVLGFLSFFV
VALGGVFVGVVYGVIAAFTSRFTAHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKHHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YCHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMERKQAIELVESGGVGKIPSA
VSTVSMQNIHPKTLPPERVLPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPVITID
PASPQSPESVDLVNEELKGRVLGLSRDPAGMAEEDGDEDGGIVMRSKEPSSPGTDDVFTP
GPSDSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGP
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgctcctgggcgccggcggctgtggcctctttcctcctcggagcttgccttcgttgctg
gtggtggtggccctggtggggctgctgcctgtgctgcggagccacggccttcagcctagc
cctactgccagcaccatccgaggctcagagcctccccgaggacgctccatcggggatgtc
accactgcccccccagaggtcaccccagagagccaccctgttaaccattctgtccctgat
catggaatgaagcatcgaaaagcctttccagtcctgggcatcgactacacacatgtacgc
aggccctttgagatttccctctggattctgctggcctgcctcatgaagatagggttccat
gtgatccccaccatctcgagcatcgtcccggagagctgcctgctcatcgtggtggggctg
ctggtgggcggcctgatcaagggcgtgggcgagacgccccccttcctgcagtcagacgtc
ttcttcctcttcctgctgccgcccatcatcctggacgccggctacttcctgccgctgcgg
cagttcacggagaacctgggcaccatcctgatcttcgccgtggtgggcacgctgtggaac
gccttcttcctgggcggcctcatgtacgctgtgtgcctggtgggcggcgagcagatcaac
aacatcggcctcctcgacagcctgctcttcggcagcatcatctccgccgtggaccccgtg
gctgtcttggccgtcttcgaggagatccacatcaatgagctcctgcacatcctcgtcttc
ggggagtccctgctcaacgacgctgtcaccgtggtcctgtaccacctctttgaggagttt
gccaactacgaccacgtgggcattgtggacatcgtcctcggcttcctgagcttcttcgtg
gtggccctgggcggggtgtttgtgggcgtggtctacggggtcatcgcggccttcacctcc
cgcttcaccgcgcacatccgcgtcatcgagccgctgttcgtcttcctctacagctacatg
gcctacctgtcggccgagctcttccacctgtcgggcatcatggcgctcattgcctcaggc
gtggtgatgcgtccctacgtggaggccaacatctcccacaagtcccacaccaccatcaag
tacttcctgaagatgtggagcagcgtcagcgagaccctcatcttcatctttctgggcgtc
tccaccgtggccggctcccaccactggaactggacctttgtcatcagcactctgctcttc
tgcctcatcgctcgtgtgctaggtgtgctgggcctgacctggttcatcaacaagttccgc
atcgtgaagctgacccccaaggaccagttcatcatcgcctatggcggcctccgaggcgcc
atcgccttctctctgggctacctgctggacaagcaccacttccccatgtgtgacctgttc
ctcaccgccatcatcaccgtcatcttcttcactgtctttgtgcagggcatgaccatccgg
cccctggtggacctgttggcggtgaagaagaagcaggagaccaagcgctccatcaacgag
gagatccacacgcagttcctggaccaccttctgacaggcatcgaggacatctgtggccac
tactgccaccaccactggaaggacaagctcaaccggttcaacaagaagtatgtgaagaag
tgcctgattgcgggggagcgctccaaggagccccaactcatcgccttctaccacaagatg
gagaggaagcaggccatcgagctggtggagagtgggggcgtggggaagatcccctctgca
gtctccactgtgtccatgcagaacatccaccccaagaccctccctcctgagcgtgtcctg
ccagccctgtccaaggacaaggaggaggagatccgtaaaatcctgaggaacaacttgcag
aagactaggcagcggctgcggtcctacaacagacacacgctggtggccgacccctacgag
gaggcctggaaccagatgctgctccggagacagaaggcccggcaactagagcagaagatc
aacaactacctgacggtgccggcccacaagctagactcgccaaccatgtctcgggcccgc
atcggatcagacccactggcatacgagccgaaggccgacctgcccgtcatcaccatcgac
ccggcctccccgcagtcgcccgagtccgtggacctggtgaatgaggagctgaaaggcagg
gtcttggggctgagccgggacccagcaggcatggccgaggaagacggggacgaggacggg
ggcatcgtgatgcgcagcaaagagccctcgtccccaggcaccgatgacgtcttcacccct
gggccgagcgacagccccagctcccagaggatacagcgctgcctcagcgacccaggcccc
caccctgagcccggggagggggagcctttcatccccaaggggccttag

DBGET integrated database retrieval system