KEGG   Tupaia chinensis (Chinese tree shrew): 102501235
Entry
102501235         CDS       T02978                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01522  Endocrine resistance
tup04012  ErbB signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04110  Cell cycle
tup04151  PI3K-Akt signaling pathway
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04934  Cushing syndrome
tup05162  Measles
tup05165  Human papillomavirus infection
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05203  Viral carcinogenesis
tup05206  MicroRNAs in cancer
tup05215  Prostate cancer
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102501235 (CDKN1B)
   04066 HIF-1 signaling pathway
    102501235 (CDKN1B)
   04068 FoxO signaling pathway
    102501235 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102501235 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102501235 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102501235 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102501235 (CDKN1B)
   05206 MicroRNAs in cancer
    102501235 (CDKN1B)
   05203 Viral carcinogenesis
    102501235 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102501235 (CDKN1B)
   05220 Chronic myeloid leukemia
    102501235 (CDKN1B)
   05215 Prostate cancer
    102501235 (CDKN1B)
   05222 Small cell lung cancer
    102501235 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102501235 (CDKN1B)
   04934 Cushing syndrome
    102501235 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102501235 (CDKN1B)
   05169 Epstein-Barr virus infection
    102501235 (CDKN1B)
   05165 Human papillomavirus infection
    102501235 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102501235 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102501235
NCBI-ProteinID: XP_006164874
LinkDB
Position
Un
AA seq 269 aa
MDVCPWTGNRSLNFLRGVLEVGAAGEPSCGLRAHHRPSPPCRPDSRLSEGGKTHRPQGSK
RATSDLRDQLAQALVSWASPSLEPMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRD
MEEASQRKWNFDFQNHKPLEGKYEWQGGEKGSLPEFYCRPPRPPKGACKVPAQESQDVSG
GRQAVPLIGAQANSEDTHLVDQKTDPSDGQTGLAEQCAGVRKRPAADDSSPQNKRANRTE
ENVSDGSPNAAAAAVEQTPKKPGLRRRQT
NT seq 810 nt   +upstreamnt  +downstreamnt
atggatgtgtgtccctggacaggaaaccggagtctcaatttcctccgtggcgtccttgag
gtgggggccgctggagagcccagctgcgggctgcgagcccaccaccggccatcacccccc
tgtcgcccagactcccggctcagcgagggcgggaaaacgcaccggccccaaggctcaaaa
cgagctacgagcgaccttcgagatcagctggcccaggccctggtttcctgggcgagcccg
agcctggagccgatggacgccagacaggcagagcaccccaagccctccgcctgcagaaac
ctcttcggcccggtgaaccacgaagagttaacccgggacttggagaagcactgcagagac
atggaagaagccagccagcgcaagtggaatttcgatttccagaatcacaagcccctggag
ggcaaatacgagtggcaggggggggagaagggcagcctgcccgagttttactgcagaccc
ccgcggccccccaaaggcgcctgcaaggtgccggcgcaggagagccaggatgtcagcggg
ggccgccaggcggtgcctttaatcggggctcaggcaaactcagaggacacgcacttggta
gaccaaaagactgacccgtcagacggccagaccgggctggccgagcagtgcgcaggggtg
aggaagcgacctgcggcggacgattcttctcctcaaaacaaaagagccaacagaacagaa
gagaacgtttcagacggttccccgaacgctgccgccgctgctgtggagcagacgcccaag
aagccgggcctccgaagacgtcagacgtaa

DBGET integrated database retrieval system