KEGG   Tupaia chinensis (Chinese tree shrew): 102501316Help
Entry
102501316         CDS       T02978                                 

Gene name
METAP1D
Definition
(RefSeq) methionyl aminopeptidase type 1D, mitochondrial
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tup01002]
    102501316 (METAP1D)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     102501316 (METAP1D)
Peptidases [BR:tup01002]
 Metallo Peptidases
  Family M24
   102501316 (METAP1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 102501316
NCBI-ProteinID: XP_006141535
LinkDB All DBs
Position
Un
AA seq 340 aa AA seqDB search
MARCRVKVLLWKCTVKNIGCHRIFSLPPSHIYLHKQSSSQQRRNVFFWRQRDVSHSVVLP
ATVSSAHPVPKHIKKPDYVTTGIIPNWGDCIEVKNEDQIQGLRQACQLARHVLLLAGKSL
KVDMTTEEIDALVHQEIISHGAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSSPLQDGDII
NIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDDAIAACRAGAPFSVIGNTIS
RITSQHGLQVCPHFVGHGIGSYFHGHPEIWHHENDNDLLMEEGMAFTIEPIITEGSPEFK
VLEDAWTVVSLDNRRSAQFEHTVLITSRGAQILTKLPHEP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcacgctgcagggtgaaagtgcttctctggaaatgtacagtgaaaaatataggttgt
catagaattttctctttaccacccagtcatatctacttacacaagcagtcaagcagtcaa
caaagaagaaatgtctttttctggagacaaagagatgtttcacacagtgtagttttgccg
gctacagtttcttccgctcacccagtccctaagcacataaagaagccagactacgtgacg
acaggcattatacccaactggggagactgcatagaagttaagaatgaagatcagattcaa
gggcttcgtcaggcctgtcagctggcccgtcatgtcctcctcctggctgggaagagttta
aaggttgacatgacaaccgaagagatagatgctcttgtgcatcaggaaatcatcagtcat
ggtgcctacccctcacctctaggctatggaggctttccaaaatctgtttgtacctctgta
aacaacgtgctctgtcacggtattcctgacagttcaccccttcaggatggagatattatc
aacattgatgtcacggtctattacaatggctaccacggagacacctctgagacgtttttg
gtgggcaacgtggatgagtgtggtaagaagttagtggaggttgccaggaggtgtagagat
gatgcaattgcagcttgcagagcaggggctcccttctctgtaattggaaacacaatcagc
cgcataacttctcagcatggtttgcaagtctgtccacactttgtggggcatggaatagga
tcttattttcatggacatccagaaatttggcatcatgagaatgacaatgaccttctcatg
gaggagggcatggcgttcactatagagccaatcatcaccgagggatcccctgaatttaaa
gtcctggaggatgcttggacagtggtctccttagacaatcgaaggtccgcccagttcgag
cacacagttctcatcacgtcgaggggtgcgcagatcctgaccaaactgccgcacgaaccc
tga

DBGET integrated database retrieval system