KEGG   Tupaia chinensis (Chinese tree shrew): 102501429
Entry
102501429         CDS       T02978                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04072  Phospholipase D signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04640  Hematopoietic cell lineage
tup04916  Melanogenesis
tup05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102501429 (KITLG)
   04014 Ras signaling pathway
    102501429 (KITLG)
   04015 Rap1 signaling pathway
    102501429 (KITLG)
   04072 Phospholipase D signaling pathway
    102501429 (KITLG)
   04151 PI3K-Akt signaling pathway
    102501429 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102501429 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    102501429 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102501429 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tup04052]
    102501429 (KITLG)
Cytokines and growth factors [BR:tup04052]
 Growth factors
  Growth factors (RTK binding)
   102501429 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 102501429
NCBI-ProteinID: XP_006154871
LinkDB
Position
Un
AA seq 273 aa
MKKTQTWIITCIYLQLLLFNPLVKTKSICENRVTDNVKDVTKLVANLPKDYMISLKYVPG
MDVLPSHCWISEMAKQLTVSLTHLLDKFSNISEGLSNYSIIQKLVKIVDDFVECMEENTP
KNVKKLSKSPESRLFSPEEFFGIFNRSIDAFKNFVVTSETRDCVISSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAANSTEDSNLQWAAMALPAFLSLVIGFGFGALYWKKK
QPNLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctcttgtcaaaactaaaagtatctgcgagaatcgtgtgactgataatgtaaaagacgtc
acaaaattggtggcaaatcttccaaaagactatatgatatccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagtgagatggcaaaacaattgacagtcagc
ttgactcatcttctggacaagttttcaaatatttccgaaggtttgagtaattattctatc
atacaaaaacttgtgaaaatagtggatgattttgtggagtgcatggaggaaaacacacct
aagaatgtaaaaaaattatctaagagcccagaatccaggctcttttctcctgaagagttc
tttggaatttttaatagatccatcgatgccttcaagaactttgtggtcacatctgaaact
agagattgtgtgatttcttcaacattaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aatagaaaagccgcaaattccactgaagactccaacctgcaatgggcagccatggcactg
ccagcattcctctctctagtaattggttttggttttggagccttatactggaagaagaaa
caaccaaatcttacaagggcagttgaaaatatacagattaatgaagaggataatgagata
agtatgttgcaagaaaaagagagagaatttcaagaggtgtaa

DBGET integrated database retrieval system