KEGG   Tupaia chinensis (Chinese tree shrew): 102501520
Entry
102501520         CDS       T02978                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102501520
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 102501520
NCBI-ProteinID: XP_006166097
LinkDB
Position
Un
AA seq 130 aa
MRCLIILALALLALEAVLAQDSYLLLSEQALCSDISSSEEEMACLKSCNTNENCQGDTKC
CLSACGFSCKTPINVPKAGRCPWVPAHISPNSCEEKDSCSWDGECTGVMKCCEDRCGMTC
MTPILENLLQ
NT seq 393 nt   +upstreamnt  +downstreamnt
atgcgctgtctcatcattctggccctggccctgctggccctggaggctgtcctcgctcaa
gattcatacctcctcttgtcagagcaggccctgtgctccgacatcagctcctcggaggag
gagatggcctgcctcaaatcctgcaacaccaacgagaactgccagggtgacaccaagtgc
tgcctcagcgcctgcggtttctcctgcaaaaccccaattaatgtcccgaaggctggtcgc
tgcccctgggtgcccgcccacataagccccaactcctgcgaggagaaggactcctgctcc
tgggacggcgagtgtaccggtgtcatgaagtgctgcgaagaccggtgtggcatgacgtgc
atgacccccatcctagagaacctccttcagtga

DBGET integrated database retrieval system