KEGG   Tupaia chinensis (Chinese tree shrew): 102501999
Entry
102501999         CDS       T02978                                 

Gene name
MYC
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04110  Cell cycle
tup04151  PI3K-Akt signaling pathway
tup04218  Cellular senescence
tup04310  Wnt signaling pathway
tup04350  TGF-beta signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04630  JAK-STAT signaling pathway
tup04919  Thyroid hormone signaling pathway
tup05132  Salmonella infection
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05216  Thyroid cancer
tup05219  Bladder cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102501999 (MYC)
   04012 ErbB signaling pathway
    102501999 (MYC)
   04310 Wnt signaling pathway
    102501999 (MYC)
   04350 TGF-beta signaling pathway
    102501999 (MYC)
   04390 Hippo signaling pathway
    102501999 (MYC)
   04630 JAK-STAT signaling pathway
    102501999 (MYC)
   04151 PI3K-Akt signaling pathway
    102501999 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102501999 (MYC)
   04218 Cellular senescence
    102501999 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102501999 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102501999 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102501999 (MYC)
   05202 Transcriptional misregulation in cancer
    102501999 (MYC)
   05206 MicroRNAs in cancer
    102501999 (MYC)
   05205 Proteoglycans in cancer
    102501999 (MYC)
   05230 Central carbon metabolism in cancer
    102501999 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102501999 (MYC)
   05225 Hepatocellular carcinoma
    102501999 (MYC)
   05226 Gastric cancer
    102501999 (MYC)
   05216 Thyroid cancer
    102501999 (MYC)
   05221 Acute myeloid leukemia
    102501999 (MYC)
   05220 Chronic myeloid leukemia
    102501999 (MYC)
   05219 Bladder cancer
    102501999 (MYC)
   05213 Endometrial cancer
    102501999 (MYC)
   05224 Breast cancer
    102501999 (MYC)
   05222 Small cell lung cancer
    102501999 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102501999 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102501999 (MYC)
   05161 Hepatitis B
    102501999 (MYC)
   05160 Hepatitis C
    102501999 (MYC)
   05163 Human cytomegalovirus infection
    102501999 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102501999 (MYC)
   05169 Epstein-Barr virus infection
    102501999 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102501999 (MYC)
   03019 Messenger RNA biogenesis [BR:tup03019]
    102501999 (MYC)
Transcription factors [BR:tup03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    102501999 (MYC)
Messenger RNA biogenesis [BR:tup03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102501999 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 102501999
NCBI-ProteinID: XP_006156750
UniProt: L9JL37
LinkDB
Position
Un
AA seq 439 aa
MPLNVSFASRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRPSGLCSPSYVAVASFSPRGDDDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSPARGHSGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDGSSPKPCASPDSTAFSPSSDSLLSSTESSPRASPEPLAL
HEETPPTTSSDSEEDQEDEEEIDVVSVEKRQPPTKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccagcaggaactatgacctcgactacgactcggtgcag
ccctatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgcccgcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcacccagccgcccatccgggctctgctcgccctcctacgtagccgtcgcgtccttc
tcccccaggggagacgacgacggcggcggcggcagtttctccaccgccgaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaagaacatcatcatccaggactgtatgtggagcggcttctccgcc
gccgccaagctggtctccgagaagctggcctcctaccaggctgcgcgcaaagacagcggc
agcccgagccccgcccgcgggcacagcggctgctccacctccagcttgtacctgcaggac
ctgagcgccgccgcctccgagtgcatcgacccctcggtagtcttcccctacccgctcaac
gacggcagctcgcccaagccctgcgcctcgccggactccaccgccttctccccgtcctcg
gactccctgctctcctccaccgagtcctctccgcgggccagccccgagcccctggcgctc
cacgaggagacacctcccaccaccagcagcgactctgaggaagaccaagaggatgaggaa
gaaattgatgtcgtttctgtagaaaagaggcagccccctaccaaaaggtcggaatcgggg
tcaccctccgctggaggccacagcaaaccccctcacagtccactggttctcaagaggtgc
catgtctccacccatcagcacaattacgccgcaccaccctccaccaggaaggactaccca
gctgccaagagggctaagctggacagtggcagagtcctgaaacagatcagcaacaaccgg
aaatgtgccagccccaggtcctcagacaccgaggagaatgacaagaggcggacacacaat
gtcctggaacgccagaggcgaaacgagctgaaacgaagcttttttgctctgcgtgaccag
atccccgagttggaaaacaatgaaaaggcccccaaagtagttatccttaaaaaagccaca
gcatacatcctgtctgttcaagcagaggagcaaaagctcatttcagaaaaggatttgtta
aggaagcggcgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system