KEGG   Tupaia chinensis (Chinese tree shrew): 102502526
Entry
102502526         CDS       T02978                                 

Gene name
NLRP4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102502526 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:tup04054]
    102502526 (NLRP4)
Membrane trafficking [BR:tup04131]
 Autophagy
  Other autophagy associated proteins
   Others
    102502526 (NLRP4)
Pattern recognition receptors [BR:tup04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   102502526 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA AAA_14 SRP54 AAA_25
Other DBs
NCBI-GeneID: 102502526
NCBI-ProteinID: XP_006166885
LinkDB
Position
Un
AA seq 983 aa
MASSFFSDFGLMWYLEELRKEEFRKFKEHLKKETLELGLKQIPWTEVKKASREDLANLLI
EHYEEQQAWDVTFRIFHQISRKDLCEKAERERTGHMKMYRAHVKKKFSNIWSRESVTGIH
DHFNQELTPEECKYLELFFAHKETGERSRTVLLKGVQGVGKTTLLIKLMLAWSENTLYQD
TFQYVFYLSCREVKQLTATSLAELISREWPNSSAPIAEIMFQPERLLFIIDSFEELKCDL
DEPESNLHNDWMEKQPVRVLLSSLLRKKMLSESSLLIAATHEYPREVEGRLECPEIKTLM
GFTEADRKLYFCCLFQDRNKAMEAFHFVRENDHLFSMCQIPLLCWIVCTSLKQEMEKGRD
LALACRRSTSLFASFIFNLFTSSGARRTRQQSQGLLISLCSLAAEGMWTDTSAFSEDDLR
RNGIADPDIPMLLGVKVLKRREDESSYTFIHMRVQEFCAAMFYLLKSHSDHPHPAVGCAE
ALLFNYLKTVKTHWILLGCFVFGLLNEKEQQRLDAFFGFQLSQKIKQQYYQYLKSLAERE
DLKRQVDFLALFYCLFEMQNEDFIRQAMHFLQDVNFSIADNSDLVVSAYCLKYCSGLKKL
QFSIQNVFQETNGHSCMSSRGIIRWHHICSVLTTNENLRELKVKNSDLNTSAFVALCDQL
RHPRCHLEKLEMNNVSFSGNMWHFFEVLVHNPGIKFLSLSSTKLARDEVTLLCDALNHPV
CNIEELRLANCGLTSDDCQVFSSVLNSSKKLKHLNVSYNYLHEGVCQLCKSLCHPDCALE
VLILAYCYLTEHCWECLSEVFLHNKSLVHLDLSANILKDEGLKILCEALKHPDCCLQSLC
LVKCFITTEGCQDLTLVLTSNQNLRSLQIGYNDVEDVGVKLLCEALIHPNCCLENLGLEA
CGLTSACCEALSSALTSCKTLRRLNLVQNALDHSGVAVLCEALRHPECALEVLGLKKAEF
DEETQTLLMAEEERNPDLRIINS
NT seq 2952 nt   +upstreamnt  +downstreamnt
atggcttcatctttcttttctgattttggccttatgtggtatctggaggaactcagaaag
gaggaattcaggaaattcaaagagcacctcaaaaaagagactttggaacttggactcaag
caaattccctggactgaagtgaaaaaagcttcccgcgaagaccttgcgaacctgttgatc
gagcattatgaggaacagcaagcatgggacgtaaccttcaggatctttcaccagatcagc
aggaaggatctctgtgagaaagctgagagagagcgcacaggacacatgaagatgtatcga
gctcacgtaaagaagaaatttagcaatatatggtccagagaatcagtcactgggattcat
gatcactttaaccaggaactcaccccggaagaatgcaaatatttagaactcttttttgct
cataaggagactggggaacgatcacgtacagtgctcctcaaaggagtgcaaggagttggg
aaaacaactctcctgattaagctaatgttggcctggtcggagaacaccctctatcaagat
acgttccagtatgtcttctacctctcctgccgagaagtgaagcagttgacagcaacaagt
ttggctgaattgatttccagggagtggcccaactcctcagcacctatagcagagatcatg
tttcaaccagagagactcttgttcatcattgacagcttcgaagagctgaaatgtgacttg
gatgaaccagagtcaaacctgcacaatgactggatggagaagcagccagtgcgggtgctg
ctgagcagtttgctgaggaagaaaatgctctccgagtcctcactgcttatcgcagccaca
cacgagtacccgcgggaggttgagggtaggttggaatgtccagaaattaaaacactcatg
ggattcacggaggcagataggaagttgtatttctgctgtttatttcaagacaggaataaa
gccatggaagccttccattttgtaagagaaaatgaccacctgttttcaatgtgccaaatc
cccctcctctgctggatcgtgtgcacgtctctgaaacaggagatggagaaggggagagac
ctagccctggcctgccgacgttccacctctttgtttgcgtccttcatcttcaacttgttc
acatccagcggtgcgcgtcgtacacgccagcagagccaaggcctgctgataagcctgtgc
tccctggctgccgagggcatgtggactgatacgtccgcgttcagtgaagacgatctgagg
agaaatggaatagctgaccctgacatccccatgttgctgggcgtaaaggttctaaagcgc
agggaggacgagagctcctacaccttcatccacatgcgtgtccaggagttctgtgctgcc
atgttctatttactgaagagccacagtgaccaccctcacccagccgttggatgtgcagag
gccctactctttaactatctaaagaccgtaaagacacactggattcttttgggctgtttt
gtatttggccttttaaatgaaaaagaacaacaacggctggatgcattttttggcttccaa
ctgtcccaaaagataaagcagcaatattatcagtacctgaagagcttagctgagcgtgaa
gatcttaagagacaggtagatttcttagcattgttttactgtctgtttgagatgcagaat
gaagacttcataaggcaggcaatgcacttcctccaagacgttaacttttctattgcggac
aactcagacttggtggtttcagcctactgcttaaaatactgttctggcttgaagaaactt
cagttttcaatccaaaatgtctttcaggaaacaaatggacacagttgtatgtcaagccgt
ggtatcatccgttggcatcatatctgctctgtgctcactacaaatgagaacctcagagaa
ctcaaagtgaaaaacagtgacctcaacacgtcagcctttgtggctttgtgtgaccagctg
aggcatcctagatgtcaccttgaaaagcttgaaatgaataacgtttccttttctggcaac
atgtggcatttctttgaggtgcttgttcataatccaggtataaaattcctgagcctcagt
tccacaaaactcgcccgggacgaagtgacgctcctttgtgatgccttgaaccatccagtg
tgtaacatcgaagagctgcggctggcaaactgtggcctcacatctgacgactgccaagtc
ttctcctcggtcctaaacagcagcaagaaactgaagcatcttaatgtatcatacaactac
ttgcatgaaggggtgtgccagttgtgcaagagtttgtgccacccagactgtgccctggag
gtcctcattttggcttactgctacctgaccgagcactgctgggaatgcctctctgaagtc
tttctgcataataagagcctggttcatctagacctcagtgcaaatatcctgaaagatgag
gggctgaaaattctctgtgaagccttgaaacacccagactgctgcctacagtcactgtgt
ttggtgaaatgtttcatcactactgaaggctgtcaagacctcaccttagttctcaccagc
aatcaaaacctgagaagtctgcaaattgggtacaatgatgtagaagatgttggtgtgaag
ctcttgtgtgaagctctgatacatcccaactgctgcttagagaacctggggctggaagca
tgtgggttaaccagtgcctgctgtgaggctctctcctctgcccttaccagctgcaagact
ctgcggagactgaacctggttcagaatgccttggaccatagtggggtagctgtgctctgc
gaggccttgagacacccagagtgtgccctggaggtgcttggcctgaagaaagctgaattt
gatgaggaaacacagacacttctgatggctgaggaagagagaaatcccgacttgaggatc
ataaacagctga

DBGET integrated database retrieval system