KEGG   Tupaia chinensis (Chinese tree shrew): 102502697
Entry
102502697         CDS       T02978                                 

Gene name
HHIP
Definition
(RefSeq) hedgehog interacting protein
  KO
K06231  hedgehog interacting protein
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04024  cAMP signaling pathway
tup04340  Hedgehog signaling pathway
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102502697 (HHIP)
   04024 cAMP signaling pathway
    102502697 (HHIP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102502697 (HHIP)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102502697 (HHIP)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 102502697
NCBI-ProteinID: XP_006169554
LinkDB
Position
Un
AA seq 700 aa
MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEVLCGGFYPRLSCCPRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPYSQ
SLFHSPERDVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYAKKDGGSCF
PDFPRKQVRGPASNYLNQMEEYDKVDEINRKHKHNCFCIQEVVSGLRQPVGALHSGDGSH
RLFILEKEGYVKIFTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDPRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCSVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRQPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTS
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQP
AQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgctcaagatgctctccttcaagctgctgctgctggccgtggctctgggcttctttgaa
ggagatgctaagtttggggaaagaagcgaagggagcggagccaggaggagaaggtgcctc
aatgggaaccccccgaagcgcctgaaaaggagagacaggcggatgatgtcccagctggag
ctgctgagtggcggagaggtgctgtgtggtggcttctacccgcggctgtcctgctgcccg
cggagtgacagcccggggctggggcgcctggagaacaagatattttctgttaccaacaac
accgaatgtgggaagttactggaggaaatcaaatgtgcactttgttctccatattctcag
agcctgttccactcacctgagagagacgtcttggaaagagacctagtacttcccctgctc
tgcaaagactattgcaaagaattcttttatacttgccggggccatattccaggtttcctt
caaacaactgcggatgagttttgcttttactatgccaaaaaagatggtgggtcgtgcttt
ccagattttccaagaaaacaagtccgagggccggcatccaactacttgaatcagatggaa
gaatatgacaaagtggacgagatcaacagaaagcacaaacacaactgcttctgtattcag
gaggttgtgagtgggctacggcagcctgttggtgccctgcacagtggggacggctcgcac
cgtctcttcattctggaaaaagaaggctatgtgaagatatttacacctgaaggagaaatt
ttcaaggagccttacttggacattcacaaacttgttcaaagtggaataaagggaggagat
gaaagaggactgctaagccttgcattccatcccaattacaagaaaaatggaaagctctac
gtgtcttataccaccaaccaagaacggtgggctatcgggcctcatgaccacattcttcgg
gttgtggagtacacagtatccaggaaaaacccccaccaagttgatccaagaacagccaga
gtgtttctcgaagttgcagaactccaccggaagcatctgggtggacagctgctcttcggc
cctgatggctttttgtacatcattctcggtgatgggatgatcacactggatgatatggaa
gagatggatgggttaagtgatttcacaggctcggtgctccggctggacgtggacacagac
atgtgcagcgtgccatactccatcccgaggagcaacccgcacttcaacagcaccaaccag
ccccccgaagtgtttgcccatgggctccatgacccaggcagatgtgccgtggaccgacag
cccactgatataaacatcaatttaaccatactttgttcagactccaatggaaaaaacaga
tcatcagccagaatcctccaaatcataaaggggaaagattatgaaagtgagccatcactt
ttagagttcaaaccattcagcaatggccctttggttggtggatttgtttaccgaggctgc
cagtctgaaagactatatggaagctatgtgtttggcgatcgtaatgggaatttcttaact
ctccaacaaagtcctgtgaccaagcaatggcaagaaaaaccactctgtcttggcactagt
ggttcctgtagaggctacttttcgggtcacatcttgggatttggagaagatgaattaggt
gaagtttacatattatcaagcagcaaaagtatgactcagactcacaatggaaaactctac
aaaatcgtagatcccaaaaggcctttaatgcctgaggaatgcagagccacagtccagcct
gcgcagacgctgacctcggagtgctcccggctctgtcggaatggctactgtacccccacc
ggcaagtgctgctgcagtccaggctgggagggggacttctgcagaatcgcaaaatgtgag
ccagcatgtcgtcatggaggtgtctgtgttagaccgaacaagtgcctctgcaaaaaaggc
tatcttggtcctcaatgtgaacaggtggacagaaacatccgcagagtgaccagggcaggt
attcttgatcagatcattgacatgacatcttatttgctggatctaacaagttacattgta
tag

DBGET integrated database retrieval system