KEGG   Tupaia chinensis (Chinese tree shrew): 102502720Help
Entry
102502720         CDS       T02978                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00020  Citrate cycle (TCA cycle)
tup00190  Oxidative phosphorylation
tup01100  Metabolic pathways
tup01200  Carbon metabolism
tup04714  Thermogenesis
tup04932  Non-alcoholic fatty liver disease (NAFLD)
tup05010  Alzheimer disease
tup05012  Parkinson disease
tup05016  Huntington disease
Module
tup_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tup_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tup_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102502720 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102502720 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102502720 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102502720 (SDHA)
   05012 Parkinson disease
    102502720 (SDHA)
   05016 Huntington disease
    102502720 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102502720 (SDHA)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102502720 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 102502720
NCBI-ProteinID: XP_014441805
LinkDB All DBs
Position
Un
AA seq 664 aa AA seqDB search
MSGVRVVSRLLRARRLALAGTQPAVFQTGTRGFHFTIDGDKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNVEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLKHVSGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSTRTSELRLSMQKSMQSHAAVFRVGSVLQEGCERIS
QLYGDLKHLRTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPLQGQQKRPFAEHWRKHTLSYVDVATGKVTLEYRPVIDRTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccgggtggtgtcgcggctactccgtgcgcggcgactggcgctggccggg
acgcagcctgcagtattccaaacagggacccgtggtttccatttcactattgatggggat
aagagggcatctgctaaagtttcagattcaatttctgctcagtatccagtcgtggatcat
gaatttgacgcagtggtggtaggcgctggaggggcaggcttgcgagctgcgtttgggctc
tcagaggcagggtttaacacggcgtgtgtcacaaagctcttccccaccaggtcacacact
gttgctgcacagggaggaatcaatgctgccctggggaacgtggaagaggacaactggagg
tggcatttctacgacactgtgaaaggctctgactggctaggagaccaggatgccatccat
tacatgacagagcaggctcccgcctctgtggttgagctagaaaattacggcatgccattt
agcagaactgaagatgggaagatttaccagcgtgcatttggtggacaaagcctcaagttt
gggaaaggcgggcaggcccatcgctgctgctgtgtggctgatcggaccggccactcactg
ttgcacactttgtatggaaggtctctgcgctatgacaccagctacttcgtggagtatttt
gccttggatctcctgatggagaatggggagtgccgtggcgttatcgcactctgcatagaa
gatgggtccatacaccgcataagagcgaagaatactgttattgctactggaggctatgga
cgcacctacttcagctgcacatccgcccacaccagtactggtgatggcaccgccatggtc
accagggctggccttccctgccaggacttggaattcgtgcagttccaccctacaggcatc
tacggtgctggctgcctcatcacagaagggtgccggggagagggaggcatcctcatcaac
agccagggcgagaggttcatggagcgctatgcccccgtcgccaaggacctggcatcccga
gacgtcgtgtctcggtccatgactctggaaatccgtgaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagctgcaccacctacccccagagcagctggccacacggctg
cctggcatctctgagacagccatgatctttgctggcgtggacgtaaccaaggagccaatc
cccgtcctccccactgtgcattataacatgggtggcattcccacaaactacaaggggcag
gttctgaagcacgtcagtggccaggaccaggtcgtgcctggtctgtatgcctgtggagag
gcagcctgcgcctctgtgcatggcgccaacaggcttggggcaaactcactcttggacctg
gtcgtctttgggcgagcatgtgccctgagcatagcagagtcctgcaggcctggagataaa
gttcctccaattaaaccaaatgctggggaggagtctgtcatgaatcttgacaagttgaga
tttgctgacggaagcaccagaacctcagaactgcgactcagcatgcagaagtccatgcaa
agccatgctgcagtgttccgtgtgggaagcgtgttgcaagagggctgtgagagaatcagc
cagctctatggagacctgaagcacctgaggacgtttgacaggggaatggtgtggaacacg
gatttggtggagaccctagagctgcagaacctgatgctgtgcgcactccagaccatctat
ggggcagaggcacggaaggagtcacgaggcgctcacgccagggaagactacaaggtgcgg
attgacgagtacgattactccaagccccttcaggggcagcagaagaggccatttgcagag
cactggaggaagcacaccctatcttacgttgatgtcgcgacagggaaggtcactctggaa
taccgacctgtgatcgacagaaccttgaatgaggccgactgtgccaccgttccccctgct
attcgctcctactga

DBGET integrated database retrieval system