KEGG   Tupaia chinensis (Chinese tree shrew): 102503238
Entry
102503238         CDS       T02978                                 

Gene name
TP53, p53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04010  MAPK signaling pathway
tup04071  Sphingolipid signaling pathway
tup04110  Cell cycle
tup04115  p53 signaling pathway
tup04137  Mitophagy - animal
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04216  Ferroptosis
tup04218  Cellular senescence
tup04310  Wnt signaling pathway
tup04722  Neurotrophin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup05012  Parkinson disease
tup05014  Amyotrophic lateral sclerosis
tup05016  Huntington disease
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05218  Melanoma
tup05219  Bladder cancer
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102503238 (TP53)
   04310 Wnt signaling pathway
    102503238 (TP53)
   04071 Sphingolipid signaling pathway
    102503238 (TP53)
   04151 PI3K-Akt signaling pathway
    102503238 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102503238 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102503238 (TP53)
   04210 Apoptosis
    102503238 (TP53)
   04216 Ferroptosis
    102503238 (TP53)
   04115 p53 signaling pathway
    102503238 (TP53)
   04218 Cellular senescence
    102503238 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102503238 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102503238 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    102503238 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102503238 (TP53)
   05202 Transcriptional misregulation in cancer
    102503238 (TP53)
   05206 MicroRNAs in cancer
    102503238 (TP53)
   05205 Proteoglycans in cancer
    102503238 (TP53)
   05203 Viral carcinogenesis
    102503238 (TP53)
   05230 Central carbon metabolism in cancer
    102503238 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102503238 (TP53)
   05212 Pancreatic cancer
    102503238 (TP53)
   05225 Hepatocellular carcinoma
    102503238 (TP53)
   05226 Gastric cancer
    102503238 (TP53)
   05214 Glioma
    102503238 (TP53)
   05216 Thyroid cancer
    102503238 (TP53)
   05220 Chronic myeloid leukemia
    102503238 (TP53)
   05217 Basal cell carcinoma
    102503238 (TP53)
   05218 Melanoma
    102503238 (TP53)
   05219 Bladder cancer
    102503238 (TP53)
   05215 Prostate cancer
    102503238 (TP53)
   05213 Endometrial cancer
    102503238 (TP53)
   05224 Breast cancer
    102503238 (TP53)
   05222 Small cell lung cancer
    102503238 (TP53)
   05223 Non-small cell lung cancer
    102503238 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102503238 (TP53)
   05014 Amyotrophic lateral sclerosis
    102503238 (TP53)
   05016 Huntington disease
    102503238 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102503238 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102503238 (TP53)
   05161 Hepatitis B
    102503238 (TP53)
   05160 Hepatitis C
    102503238 (TP53)
   05162 Measles
    102503238 (TP53)
   05168 Herpes simplex virus 1 infection
    102503238 (TP53)
   05163 Human cytomegalovirus infection
    102503238 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102503238 (TP53)
   05169 Epstein-Barr virus infection
    102503238 (TP53)
   05165 Human papillomavirus infection
    102503238 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102503238 (TP53)
   01522 Endocrine resistance
    102503238 (TP53)
Transcription factors [BR:tup03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102503238 (TP53)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102503238 (TP53)
DNA repair and recombination proteins [BR:tup03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102503238 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer TAD2 P53_TAD DEC-1_N
Other DBs
NCBI-GeneID: 102503238
NCBI-ProteinID: NP_001274298
LinkDB
Position
Un
AA seq 393 aa
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP
DEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK
SVTCTYSPDLNKLFCQLAKTCPVQLWVDSAPPPGTRVRAMAIYKQSQYVTEVVRRCPHHE
RCSDSDGLAPPQHLIRVEGNLHAEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDSSGKLLGRNSFEVRICACPGRDRRTEEENFRKKGESCPKLP
TGSIKRALPTGSSSSPQPKKKPLDEEYFTLQIRGRERFEMLREINEALELKDAMAGKESA
GSRAHSSHLKSKKGQSTSRHRKLMFKTEGPDSD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaggagccgcagtcagatcctagcgtcgagccccctctgagtcaggaaacattttca
gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcaatg
gatgatttgatgctgtccccggacgatattgaacaatggttcactgaagacccaggtcca
gatgaagctcccagaatgccagaggctgctccccccgtggcccctgcaccagcagctcct
acaccggcggcccctgcaccagccccctcctggcccctgtcatcttctgtcccttcccag
aaaacctaccagggcagctacggtttccgtctgggcttcttgcattctgggacagccaag
tctgtcacctgcacgtattccccggacctcaacaagctgttttgccagctagcaaagacc
tgccccgtgcagctgtgggtggactcggcgcccccgcccggcacccgtgtccgggccatg
gccatctacaagcagtcacaatacgtgacagaggtcgtgagacgctgcccccaccacgag
cgctgctctgacagcgatggtctggccccgcctcagcatcttatccgggtggaaggaaac
ctgcacgcggagtattcggatgacagaaacactttccgacacagtgtggtagtgccctac
gagccgcccgaggtcggctctgactgcaccaccatccactacaactacatgtgcaacagc
tcctgcatgggcggcatgaaccggcgccccatcctcactattatcacgctggaggactcc
agtgggaagctgctaggacggaacagcttcgaggtacgcatttgtgcctgtcctggaaga
gaccgacgcacagaggaagaaaatttccgcaagaaaggggagtcttgtcccaagctgccc
actgggagcattaagcgagcactgccgactggttccagctcttctccacagccaaagaag
aaaccactggatgaagagtatttcacccttcagattcgtgggcgtgaacgcttcgagatg
ctgcgagaaattaatgaggccttggaactcaaggatgccatggctgggaaagagtcagcg
ggcagcagggctcattctagccacctgaagtccaagaagggccagtctacctcccgccat
agaaaactaatgttcaaaacagagggacctgactcagactga

DBGET integrated database retrieval system