KEGG   Tupaia chinensis (Chinese tree shrew): 106734783Help
Entry
106734783         CDS       T02978                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04115  p53 signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04218  Cellular senescence
tup04510  Focal adhesion
tup04931  Insulin resistance
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05206  MicroRNAs in cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05222  Small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05230  Central carbon metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106734783
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106734783
   04070 Phosphatidylinositol signaling system
    106734783
   04071 Sphingolipid signaling pathway
    106734783
   04151 PI3K-Akt signaling pathway
    106734783
   04150 mTOR signaling pathway
    106734783
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106734783
  09143 Cell growth and death
   04115 p53 signaling pathway
    106734783
   04218 Cellular senescence
    106734783
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106734783
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106734783
   05206 MicroRNAs in cancer
    106734783
   05230 Central carbon metabolism in cancer
    106734783
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106734783
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    106734783
   05214 Glioma
    106734783
   05218 Melanoma
    106734783
   05215 Prostate cancer
    106734783
   05213 Endometrial cancer
    106734783
   05224 Breast cancer
    106734783
   05222 Small cell lung cancer
    106734783
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    106734783
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106734783
   05165 Human papillomavirus infection
    106734783
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106734783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    106734783
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106734783
    3.1.3.48  protein-tyrosine-phosphatase
     106734783
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106734783
Protein phosphatases and associated proteins [BR:tup01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106734783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2
Motif
Other DBs
NCBI-GeneID: 106734783
NCBI-ProteinID: XP_014442993
UniProt: L9KZU4
LinkDB All DBs
Position
Un
AA seq 82 aa AA seqDB search
MNLIIIDIKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTCVTPDVSDNEPDHYRYSD
TTDSDPENEPFDEDQHTQITEV
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgatcattatagatattaaagacaaagccaaccggtatttttctccaaatttt
aaggtgaagctgtacttcacaaaaacagtagaggagccatcaaatccagaggctagcagt
tcaacttgtgtaacaccagatgttagtgacaatgaacctgatcattatagatattctgac
accactgactctgatccagagaatgaaccttttgatgaagatcagcatacacaaattaca
gaagtctga

DBGET integrated database retrieval system