KEGG   Tetranychus urticae (two-spotted spider mite): 107359841Help
Entry
107359841         CDS       T04901                                 

Definition
(RefSeq) hepatocyte growth factor receptor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Brite
KEGG Orthology (KO) [BR:tut00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tut01001]
    107359841
Enzymes [BR:tut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107359841
Protein kinases [BR:tut01001]
 Receptor tyrosine kinases (RTK)
  MET family
   107359841
Cytokine receptors [BR:tut04050]
 Receptor tyrosine kinase
  RTK class VI (HGF receptor family)
   107359841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Sema TIG PSI Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107359841
NCBI-ProteinID: XP_015781909
LinkDB All DBs
Position
Unknown
AA seq 1360 aa AA seqDB search
MFDHHHVHCSPIINFILRLSQNFCSKKVTIFLVLLIISCLSEFNHAQIHKENIGESDVKY
LSVDFETSIQKLLLTTSNQLFVGARNKFIKVDVDNLKIIQEFKIQILKDSPECPPDPEPC
PSNKARSIMQADCKNLFPFNVSSETTIFACYSTNQGMCYIFRQSDLTKGRLIGSPSQVSN
YVASRSSSFVVPVSAGNTTHIFVAHAYDGRPVNLSPPTLSNRKLVSSLRQINLDYSVNTK
SAFTAIDLRNNYKTSFPLNYIYGFQDGDYVFFVKTEPNSLKGDRIVTKVARVCTNDYYFG
SYSEIEVKCSEQTKATTAVIGKMDTYLRNTFADSVTSHQSPNALFISFENHRVKSQSING
HQETRVCAFGISKLSSLFDEAKRKCYSTRDGSMIESLSEPGSRCTENQLETCSTVINKFI
KVPEPLDGLLVYGDRHRLTSLVSVLQGPTTPLRQALFVGTENGFIKKIVSGRDIFSVGIS
KSSIEPGAVVDASEENIFFASDKSLIKLPIKTCLFYQDCGSCIESLGKDTVRCVWDGKKC
VLDDGKIAGKNYCEPRITSFSPRKGPTAGGTVVKVKGIDLGFHDETQNTENEIKVAGLKC
SIRSWNYTEIICAISGSTEVAKSGPIELKVKDISSRKPYDIQGSATSSEKFEFLTPSVKN
VEPKYSPLAGGVDVFIHGENLDIGSNISIALANFPCTSIQIIDSSVIHCVAGPAIASDQL
TGPVKIKIDSALIVPEINFSYLLDPSFSSISPNVTSATSGVNISVFGDHFDSLFKPRLVI
NAIVPRASSPLILESDCTLINASCLICPSPIMPSDISFEASIPATIAFANGGSDRFIQTD
FILVYHPDPKFSNKIVTTQGNDGGRTLEIMGQHLSTGYGMRVLLVNQLDGATLECGNLRS
IDNSLITCDIPLNDYPGDPTSSLWNISVIAGSKQALIGMVPIEPEDSSSTTIAGFIVGLI
AILVVIALIMMYLLKRNGYLLSKKGPPPSLGVTFRSENGQFQRQGSQNEYHGPDGRISGQ
PLLFDRQSEEIKFVIEPQKQAELQADGILFSRDYLTREKVIGQGNFGLVFKGYLQLPNKE
DKIKVAIKTLKTDRGILSQDKGEAFLAEGLIMKEFCHENVLSLIGVSIDFDGSPMIITPF
MEHGDLRSYIQREDLEFTVIDLIQFGVQVAQGMVYLASLKFVHRDLAARNCMVDEHHTVK
VADFGLSRDVYTTSYYSDADNFRKPLPRKWMAIESLERGNYDTKSDVWSYGVLLWELLTR
GDIPYPDVDDWKMKDYLKVGYRLPRPEHCPPEVYSVMKECWVEDPKSRPTFEEILKLIEV
AIESNEKKYLEQKTNRNIRYINDPSIFTNPHYDGSLVTNS
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaccatcaccatgttcattgttcacctatcatcaattttatactaaggctttct
caaaacttttgttccaagaaagtcaccatctttctagttttattaattatttcatgtttg
tcagagtttaatcatgcacagattcacaaagaaaacatcggtgaatcagatgtcaaatat
ttaagtgttgattttgaaacatctatccagaaattacttttaaccacgtctaatcaatta
tttgttggtgctcgaaataaatttatcaaagttgatgttgataacttgaaaattattcaa
gaatttaaaattcaaatcttaaaggattctccagagtgtccacctgatcctgagccatgt
ccttcaaacaaagctcgttctatcatgcaagctgactgtaaaaatttgtttccattcaat
gttagctctgaaacaactatatttgcctgttactcaaccaatcaaggaatgtgctatatt
tttcgacaatctgatctaacgaaaggtcgacttattggttcacctagccaagtatcaaat
tacgttgcctctcgatcaagtagttttgttgttcctgtgtctgctggcaacacaactcat
atttttgtagctcacgcctatgatggtcgtccagtcaatctaagtccaccaactttgtcc
aatcgaaaattagtcagttcacttcgacaaatcaatttggattattctgtaaataccaaa
tctgcatttaccgccatcgatttaagaaacaactacaaaacctcgtttccattgaattac
atatatggatttcaagatggagattacgtattttttgtgaaaacggaacctaactcttta
aaaggagatcgaattgtaacgaaagtggctcgtgtgtgtacaaatgattactattttggc
tcctatagtgagattgaagttaaatgctctgagcaaactaaagcaaccacagcagttatt
ggtaaaatggatacctatttacggaacacttttgctgattctgtgacctctcaccagtca
ccaaatgccctatttatctcttttgaaaatcatagagtaaaaagccaatctattaatggg
catcaagaaacgcgggtttgtgcatttggcatttccaagttgtcatctctgtttgatgaa
gctaaacgtaaatgttattctactcgagacggatccatgattgaatcattatctgaacct
ggttctcgatgtactgaaaatcaattagaaacatgtagcactgttatcaacaaattcatc
aaagtgcctgaaccattggatgggcttcttgtttacggtgatagacatcgattaactagt
ttagtctcagtgttacaaggtccaactactcctcttaggcaagctttatttgttggaaca
gaaaatggatttataaaaaagattgtcagtggtcgtgatattttctcagttggtataagc
aaatcttccatcgaacctggtgctgtggttgacgctagtgaagaaaacatttttttcgcc
tctgataaatcgctgatcaaacttcccataaaaacatgtttattctatcaggattgtgga
tcttgtattgaatcactaggtaaggacaccgtcagatgtgtttgggatggtaaaaagtgt
gttctcgatgatggtaaaattgctggtaaaaattattgtgaaccgagaataacttcattc
tcacctcggaaagggccaactgctggaggaactgtcgtcaaagttaaaggaatagacttg
ggttttcatgatgaaactcaaaatactgagaatgaaataaaagtcgcaggattaaaatgt
tcaataagatcctggaattatacagaaatcatatgtgccataagtggatctacagaagtc
gctaaatcaggtccaatagagttgaaagtcaaagacatttcctctcgaaaaccctatgat
atccaaggaagtgcaactagctcagaaaaattcgaatttttgactccaagtgtgaaaaat
gttgagcccaaatattctcctttagctggtggggtcgatgtattcattcatggagaaaat
ttggatattgggtcaaacatatcaatagctttggcaaattttccatgtacatctattcaa
atcattgacagctcagttatacattgtgttgcaggtccagccatagcttcagaccagctg
actggtccagttaaaattaaaattgattctgcattaatagtaccagaaattaatttttcc
taccttcttgatccatctttttcatccatttctcctaatgtaaccagtgcaacctccggt
gttaatatttcagtctttggagaccattttgatagtttattcaaacctcgccttgttatc
aatgccattgttcccagagcatcatcacctctcatccttgaaagtgattgtacactaatc
aatgcttcttgccttatctgtcctagtccaataatgccatctgatatttcctttgaagct
tcaataccagcaacaatagcctttgccaatggtggatctgatagatttatacaaactgat
tttattttagtctaccatccagatcctaaattttcaaataaaattgttaccactcaaggt
aatgatggcggtcgtactctcgaaattatgggccaacatctgagtacaggttatggaatg
agagttttactcgtaaaccaactggatggagcaactttggaatgtggaaatttacgatcc
attgataatagtctaattacatgtgatattcctttaaatgattatcccggtgatccaacc
tcttccctctggaatatatcggtaattgctggaagcaaacaagctctcatcggaatggtt
cccattgaaccagaagattcatcgagcacaaccatcgcaggatttattgttggtttgatt
gctattttagtggtgatcgcattaataatgatgtatcttcttaaacgcaatggttacctg
ttgagtaaaaaaggacctccaccttccctaggagttactttcagatctgaaaatggtcaa
tttcaaagacaaggctcacaaaatgagtatcatggacctgatggaaggatttctggtcaa
cctttgttgtttgatcgacaatcagaggagatcaaatttgttattgaacctcaaaaacag
gctgaattacaagctgatggcatattatttagtcgagactatttaaccagagaaaaggtc
attggtcaaggaaactttggccttgtttttaagggttaccttcagctaccaaataaagag
gataaaatcaaagttgccataaaaacactaaaaacagatcgaggtattttatcacaagat
aaaggtgaagcgttccttgctgaaggtctcattatgaaagagttttgccatgaaaatgta
ttgtctttgattggtgtttcaattgattttgatggttcaccgatgataatcactccattc
atggaacatggtgatttaagatcatacattcaacgggaagacctggaattcactgttatt
gatttaattcaatttggcgttcaagttgctcaaggaatggtttatttagcttcacttaaa
tttgtccatagagacttagcagctcgtaattgcatggttgatgaacatcatactgttaaa
gttgctgattttggcttatctcgagacgtttatactaccagttattattcagatgctgat
aattttagaaaacctttacctcgaaaatggatggccattgagagtctggaaagaggcaat
tatgacactaaaagcgatgtctggtcttatggagttttactttgggaattattgactcga
ggtgacattccatatcctgatgttgatgattggaagatgaaagattatctcaaagttggt
tatcgattacctaggcctgagcattgtccacctgaagtgtattccgttatgaaagagtgt
tgggttgaggatccaaaaagtcgaccaacctttgaagagatcttgaaattaattgaagtt
gccattgaaagcaatgagaaaaaatatctggaacaaaaaactaaccgaaatattcgttat
atcaatgatccctcaatctttaccaatcctcattatgatggatcattagttaccaacagt
taa

DBGET integrated database retrieval system