KEGG   Tetranychus urticae (two-spotted spider mite): 107360007Help
Entry
107360007         CDS       T04901                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00040  Pentose and glucuronate interconversions
tut00051  Fructose and mannose metabolism
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107360007
   00051 Fructose and mannose metabolism
    107360007
Enzymes [BR:tut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     107360007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 107360007
NCBI-ProteinID: XP_015782101
UniProt: T1K316
LinkDB All DBs
Position
Unknown
AA seq 351 aa AA seqDB search
MVKQSLVFVKPHELRIDEYQKDDEPSETEVLIDVAACGICGSDLHWHLSGRIGPFKAKEN
AIMGHEASGTIVKVGSKVTNVKPGDRVCIEPHEPCWTCDFCRIGSNNLCPYGDVSSCGAN
KNGFFRSTNVWPAILCHKLPESMTLEEGALVEPVACAVWAIKRAKLEGNDSIFITGAGPI
GLLCLMVSKAFGAGKICITDLNEKRLSIAKSLGADYTLLTTPGETSEEIAEKVKKIMGGP
PDVTIDCTGVGACINTCILTAQRGGKVLLQGLSASLSSVDLTIASIKQLNLIGVNRFNNT
FPTAIDLISSGRVNAKGLISHVISLEDYQTAFDALKKGQGVKILLSPKHNK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggttaagcaaagtttagtatttgtaaagccacatgaattacgtatcgatgaataccag
aaagatgatgagccatccgaaacagaggttttgattgatgtagctgcttgtggtatttgt
ggcagtgatcttcattggcacctttccggtagaatcggtccattcaaagccaaggagaac
gcaattatgggccatgaagcaagtggaaccattgtcaaagttggatccaaagtaaccaac
gtcaagccaggtgatagagtttgtattgaaccacatgaaccctgttggacctgtgatttc
tgtcgaatcggatcaaataatttgtgtccctatggtgatgtatcaagttgtggagcaaat
aagaacgggttcttccgatcaaccaatgtttggcctgctattttgtgccataaattacca
gaaagcatgacactcgaagaaggtgctttggttgagccagttgcttgtgctgtctgggca
ataaaacgagccaagctagagggcaatgattcaatctttatcaccggtgctggtccaatt
ggtttattatgtttgatggtttccaaggctttcggtgctggcaaaatatgcataactgat
ttaaatgaaaagcgtttgtccattgccaaatctctaggagcagattacacattgttaacc
actcctggtgaaacatcggaagagattgctgaaaaggttaagaaaataatgggtggacca
cctgatgttacgatagattgtactggtgttggtgcatgtatcaatacatgtattttgaca
gcccaaaggggtggcaaagttttattgcaaggattaagcgctagcttatctagtgttgat
ttaactattgcatcgataaaacagctaaatcttattggtgttaaccggttcaataataca
ttcccaactgctattgatctcatctccagtggacgggttaatgccaaaggtttgatcagt
catgtaattagcttggaggattatcaaacagctttcgatgctcttaagaagggccaagga
gttaaaatattactttcaccaaaacataataaataa

DBGET integrated database retrieval system