KEGG   Tetranychus urticae (two-spotted spider mite): 107360718Help
Entry
107360718         CDS       T04901                                 

Definition
(RefSeq) armadillo segment polarity protein-like
  KO
K02105  catenin beta 1
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tut00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107360718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 KAP Adaptin_N HEAT_2 Atx10homo_assoc
Motif
Other DBs
NCBI-GeneID: 107360718
NCBI-ProteinID: XP_025016238
LinkDB All DBs
Position
Unknown
AA seq 777 aa AA seqDB search
MSRALNSSRTQRIRAAMFPETIDEAGELPVNNGTNGNHTNGNHTNGNANNINMNNLTLNN
SSSVVNRLAEPAQMLKHAVTNLINYRDDAELATRALPELMKLLNDEDSVVVTQASMMVHQ
LSKKEASRHALMNSPQMVTSLVRAMASTTDIEVTKNAAGILQNLSQHRQGLLAIFKSGGI
PALVKLLSSPIEPVVFHAITTLHNLLLHQEGSKMAVRLAGGLQKMVALLNRNHVKFLTLV
TDCLQILAYGNQEGKLIILASGGPQLLVNIMTTYNYEKLLWTTSRVLKVLSVCSSNKPAI
VQAGGIQALAMHLNSESNRLVSNCLWTLRNLSDAATKLDGMNGLLQNLVHLLSTNDPGYA
ITAAGVLSNLTCNNPVNKAIVCQVGGVEALVRVVIQAGDAEETIEPAICALRHLTNRHPS
SEVAQNAVRINYGLPVIVKLLNPPSRWPLIKAVIGLIRNLSLCPANHGPLREQNVLQRLV
QLLSKAFLESQRHKASVAAAANGPGGGSGTGAGTTLYSEGVKMDEIVEGTVGALHVLAKD
PHNRAIIRSLNVIPTFVQLLYSEIENLQRVAVGVLCELAGDKEGAEMIEAEAATAPLTEL
LHSRNDGVATYAAAVLFRMSEDKPSDYKKRLSMELTSSLFREDASNWVAGPGELDMNLIA
VDDGFSSHLFSEPLAAGVGGGSASVHSTLSRSNPYSTGAGGAGGAGLGPGDLMTGITNRT
GYPTNTMNPSLESTVTFDPLMTNGQQNLGTQGNQGTTMNPSGQSLDNTMAAWYDTDL
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagcgttgaattcatctcgcactcaacggattagagcggcaatgtttccagaa
acgatagatgaagccggtgaattgccagtaaacaatggtaccaatggtaaccacacaaat
ggtaatcataccaatggtaatgcaaataatataaatatgaataatttaacactaaacaat
tcaagctctgttgttaatcgacttgctgaacctgctcaaatgttgaaacacgcagtaact
aatttgattaattatcgtgatgacgctgaattagcaactagagctttaccagaattaatg
aaattattaaatgacgaagattcggtagttgtaactcaagcatcaatgatggttcatcaa
ttatccaaaaaagaagcctctcgacatgcactcatgaactctcctcaaatggttacctct
ctagtcagagcaatggcgtcaacaactgatattgaagtgacaaaaaatgctgctggtatt
ttacaaaatttatcccaacatcgacagggtttattagcaatattcaaatcaggtgggatt
cctgctctagtcaagcttttatcttcacctatcgaacctgttgtatttcacgccatcact
actttacataatcttcttctgcaccaggaaggatcgaaaatggcagtcagattggctggt
gggttacaaaaaatggttgcactcctaaatcgtaatcacgtcaaatttctaactttggta
actgattgtcttcaaatattggcttatggaaatcaagagggaaaattgataatcctagct
tccggcgggcctcagcttttggtcaacataatgactacttataattatgaaaagttatta
tggacaacttcacgtgttctaaaagtattatccgtatgttcatctaataaaccagcgatt
gttcaagcgggaggaattcaagctttagcgatgcatcttaactcagaatcgaatcgactt
gtttcaaattgtttgtggactctgcgaaatctatctgatgcggcaaccaaattagatgga
atgaatggtttattacagaatctggttcatctgttgtccacaaatgatcctggatatgcg
attactgcagcaggagtattgtccaatttaacttgtaataatccagttaacaaagcaatc
gtttgtcaagttggtggagttgaagcgctggttcgtgttgttattcaagctggtgatgct
gaagaaacgattgaaccagcaatatgtgcattgagacatttaaccaaccgccatccaagt
tcagaagtggctcaaaatgccgtgagaataaattatggacttccagttattgtcaaactt
ctcaacccaccttctcgatggccattgatcaaagcagttattgggttaataagaaactta
tccttatgccctgctaaccatggaccattacgagaacaaaatgtacttcagagattggtc
cagttgttgtccaaagcatttcttgaatcacaaaggcacaaagcatctgtagctgctgct
gctaatggtccaggagggggcagtggaactggggcaggaacaacactttattcagaaggt
gtaaaaatggatgagatagttgaaggaactgtgggtgctcttcatgttcttgcaaaagat
ccacacaacagagcgataatacgaagtctcaatgttataccaacctttgttcaactgttg
tacagtgagattgaaaatcttcaacgagtggcggttggtgtcctctgtgaattggctggg
gacaaagaaggagctgaaatgatcgaagcagaagcagccacagcaccattgaccgagctt
cttcattcacgtaatgatggtgttgctacttatgcagctgctgtactgttcaggatgtca
gaagataaaccatctgattacaagaaaagactatcaatggaattaacttcgtctttattc
cgtgaagatgcaagtaactgggtggctggaccaggcgaattagatatgaacttgatagca
gttgatgatggtttttcaagtcacctattttctgagcccttagcagcgggagttggagga
ggttcagcttcagttcactcaacattatctcgatctaacccttactcaaccggagccgga
ggtgctggtggagccggattaggcccaggagatctaatgactggtattacaaacaggaca
ggttatccaactaacactatgaatccttcactagagtcaacagttacttttgatcccctc
atgaccaacggacagcaaaatctaggtactcaaggtaatcagggtacaacgatgaatcct
tcaggtcaatcattagataatacaatggcagcttggtatgacactgatttataa

DBGET integrated database retrieval system