KEGG   Tetranychus urticae (two-spotted spider mite): 107361061Help
Entry
107361061         CDS       T04901                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00052  Galactose metabolism
tut00500  Starch and sucrose metabolism
tut01100  Metabolic pathways
tut04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107361061
   00500 Starch and sucrose metabolism
    107361061
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107361061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tut04147]
    107361061
Enzymes [BR:tut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107361061
Exosome [BR:tut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107361061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107361061
NCBI-ProteinID: XP_015783274
UniProt: T1K6T2
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MEEKKPKFCESPYLYPSEEPQSRGISFRRFIIIVTLLNFVAISIITGYVLYNVWLLETTI
DEPFVDWQKDDSKPLITTYYESSFTSGGVFRAPAPSKADPKSPQCTLPNESKFDCNPDEP
VNQQVCESRGCCWVPVTRSKRNIPLNIPYCFYPSDYKLYDVADIKQGDNNATLKLVRKTA
SGFPDEIDNVNVEIIGLDSERLRVRFVDAEKDRFEVPMPFFNLSKAEQIKSPLYKIKIND
DGKLQISRASTGTIIFNADLSTLIYADKYIQLHVHVPSTYLYGLGEHKAPFKKDLTGWNR
YTMFARDIGPTENVNLYGSYPFYIMPEGDDKMNAHGVFLLNSNAMDVLTQAAPAITYRTV
GGILDFFIFLGPSAPEVVRQNVNLIGRPVLQPQWAFGFHLCRYGYNSLAKTRETLDRNLA
AGIPVEAQWNDIDYMDRYNDFTYDKNNFAGLGDFVKELHSKNMHYVIILDPGVSAAEPAG
TYPPYDDGVKADIFIKNTTNQIFVAKVWNLVSTAYPDFTNPATVDYWKNQLMNLRKEVEF
DGIWIDMNEPSNFLDGQFNGCPNDPYENPPYKPGGNNLRSRTVCMTAKQHLGIHYNLHNL
YGLYENVVSYKASLDIFGARPFILSRSTYPSQGHYASHWSGDIQSSWDHMKYSISNMLEF
NIYGIPMIGSDICGFNGNTEVELCMRWSALGAFYPFSRNHNDIHGTEQDPAILGPTVVAA
AKYALGARYKLLPYLYTLFAKANMNGDTVVRSLFFEFPLDKNTYAIETAFLWGSSLYIVP
VLEAQKTQVDAYFPNELWYNFDDKKLAFNSTGETKTITIDNDKIGLFMRGGSIVPVYQNS
ANTTAELRKQKYYLNAYLDRSGNAVGEIYHDDGKSVDSIEAGNYIHASCKANKERLVCSY
RNMAEFDDYRVGGVTISGLHEQPKKINLNGQFLSSNSYSHDGSTLSIELPDDFYSSQSFA
IEFRY
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaaagaagccaaaattttgtgaatcaccttatttatatcctagtgaagaacca
caatcgcgtggtatttctttccgacgatttataatcatcgttacattgttgaattttgtt
gccatttctatcataactggttacgttttatacaatgtatggttactcgagacaacaatc
gacgaacccttcgttgattggcaaaaggacgattcaaaacctttgataacaacttattac
gagtccagttttacttcgggtggtgtttttagagcacctgcccctagcaaagctgacccg
aaatctccacaatgtactttgcccaatgaaagtaaatttgattgtaaccctgatgaacct
gttaaccagcaagtttgtgaatcaagaggatgttgttgggttcctgttacaagaagcaaa
cgtaatatacctcttaatataccttactgtttctacccaagtgactacaagctttatgat
gttgctgatatcaaacaaggtgataacaatgcaacgctcaaacttgttcgtaaaaccgcc
tctggtttccctgatgaaattgataatgtaaacgttgagataatcggactcgatagtgaa
cgacttcgagtaagatttgttgatgctgaaaaggatcgttttgaagttccaatgcccttt
ttcaatttatcaaaagcagaacagattaaatcacctttgtacaaaattaaaatcaatgat
gatggaaaattgcaaattagccgagcatcaactggaactatcatatttaatgctgatctt
tcaacactgatttacgctgataaatatattcaactacatgttcacgtcccttctacctat
ctttatggtcttggtgagcataaagctcctttcaagaaagatttgactggttggaatcga
tacacaatgtttgcccgtgatattggtccaactgaaaatgtcaacctctatggttcttat
ccattttacataatgcctgaaggtgatgataaaatgaatgcccatggagtatttttgctc
aacagcaatgccatggacgttcttactcaagctgctccagctatcacttatcgaactgtt
ggtggtattcttgactttttcattttcttgggtccatcagcacctgaagttgttagacag
aatgtcaatcttattgggcgaccagtacttcaacctcaatgggctttcggatttcatctt
tgtcgttacggttacaatagtttggctaaaactcgcgaaacattggaccgaaatttagct
gctggaattccagtcgaagcacaatggaatgacattgattacatggatcgctacaacgat
tttacttatgataaaaacaattttgctggtcttggtgattttgtcaaagagttgcattct
aagaatatgcattatgtcattattttggatcctggtgttagtgctgcggaaccagctgga
acatatccaccatatgacgatggagttaaggctgatatttttatcaaaaataccactaat
caaatttttgtcgccaaagtttggaatcttgtgtcaactgcttatcctgatttcaccaat
ccagctacagttgattattggaagaaccaattaatgaacttgcgaaaggaagttgaattt
gatggcatttggattgacatgaatgaaccatctaacttcttggatggtcaattcaatgga
tgtcctaacgatccttatgaaaacccgccctataaacccggtggaaataatctcagatcc
agaacagtttgtatgactgccaaacaacaccttggtattcattacaatcttcataatctt
tacggactttacgaaaatgttgtctcctacaaggcttctctcgatatttttggagctcgg
ccattcattctttctcgttcaacttacccttcacagggtcattatgcttctcactggtct
ggagatattcaatcatcttgggatcatatgaaatattcaatttcaaacatgcttgaattc
aatatttatggaattcccatgattggaagtgatatttgcggtttcaatggtaatactgag
gtagagctttgcatgagatggtcagcattaggtgctttctacccattttcgcgtaatcac
aacgacattcatggaaccgagcaagatccagccattttaggaccaactgttgtcgctgca
gctaaatatgccttgggcgctcgctacaaactattgccatatctttacaccttatttgct
aaagctaacatgaatggagatactgttgttagatcactgtttttcgaatttcctttggat
aaaaatacttatgcaattgaaaccgctttcctttggggttcaagtttatatattgtccca
gttctggaagctcaaaaaactcaagttgatgcttacttcccaaatgaactttggtataat
ttcgatgataaaaaactagcatttaacagtactggtgaaaccaaaactataacgattgac
aatgacaaaattggtcttttcatgcgaggaggatcaatcgtgcctgtgtatcaaaactca
gcaaacacaactgctgagctcagaaaacaaaaatactatttgaatgcttacctcgatagg
tcaggaaatgcagttggtgaaatttaccatgatgatggtaaatcggttgacagtattgaa
gctggcaattatattcacgcaagttgcaaagctaacaaagaacgactagtctgcagttat
aggaatatggcggaattcgatgattacagagtcggaggtgttacaatttcgggactccat
gaacaacctaaaaagataaatctcaatggacaatttttatccagtaacagttactctcat
gatggatcaacactctcgattgagctgcctgacgacttttactcttcacaatcatttgct
atcgaatttagatattaa

DBGET integrated database retrieval system