KEGG   Tetranychus urticae (two-spotted spider mite): 107361357Help
Entry
107361357         CDS       T04901                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00052  Galactose metabolism
tut00500  Starch and sucrose metabolism
tut01100  Metabolic pathways
tut04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107361357
   00500 Starch and sucrose metabolism
    107361357
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107361357
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tut04147]
    107361357
Enzymes [BR:tut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107361357
Exosome [BR:tut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107361357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 107361357
NCBI-ProteinID: XP_015783663
UniProt: T1K729
LinkDB All DBs
Position
Unknown
AA seq 967 aa AA seqDB search
MQEKKPKCCESQTYLYPSKEPSSNVFSSRRCLIIILFLNFVTISIITGYVLYNERLLEST
IDKPFVDWQRDDSTHYIATYYASSLNSNGVFKAPPPSKTDSTSKQCTLADENKFDCNPDE
PVSQQVCESRGCCWVPVTIKKRNVQSLNVPQCFYPSDYKGYEIADVQQEKNSALIKLVRK
VASGFPQDISNVSVEITGLDDERLRIRFVDAEKDRFEVPMPFFNVSEAEQFNSTLYKITI
NQDGKLLVSRTSTGTVIFNADLSTLIYSDKFIQLSVRVPSQYLYGLGEHKASFKKDLTGW
NRYTMFARDIGPTEGVNLYGSYPFYIMPEDDDSMNAHGVFLLNSNAMDVITQSTPAITYL
TIGGILDFFLFLGPTASQVARQNINLIGRPVLQPYWSFGFHLCRYGYDSLNKTRETLERN
LAVGIPIEAQWNDIDYMDRFNDFTYDKVNYAGLGDFVKELHSKNMHYVIILDPGVSAAEP
AGTYPPYDDGVKADIFVKNSTDQIFVGKVWNLVSTVYPDFTNPATTDYWKNQLVNLRKEI
DFDGIWIDMNEPSNFYNGQIDGCPNDPYEKPPYVPGGTDLKTKTLCMNAKQYAGIHYNVH
SLYGLYENVVTYNAALDIFKARPFILSRSTYPSQGHYASHWSGDIESSWDHMKYSISNML
EFNVYGIPMIGSDICGFAGNTEVELCMRWSSLGAFYPFSRNHNDKNKLEQDPAILGETVV
AAAKYALEARYKMLPYLYTLFAKANMNGDTVVRSLFFEFPLDKNTYSIETAFLWGSSLYI
IPVLEPQKTQVDAYFPNELWYNFEDKKLAFNSTGESKTIQIDNDKIGLFMRGGSIVPVYQ
SSANTTTELRKQKYYLNGYLDKSGHAVGEIYHDDGKSIDSIESGIYIHADCKANKDHLVC
NYLNMATFDDFNIGGVTISGLSEKPKRINLNGKSLSTDSFTHDDSILTIELPEDFNSSQS
FSIDFSY
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaagaagccaaagtgttgtgaatcacaaacttatttatatcccagtaaagaa
ccttcttctaatgttttttcttcacgacgatgtttaataataattttattcttgaatttt
gttaccatttctattattactggatacgttttgtacaatgaacggttgttagaatcaaca
attgacaagccttttgtcgattggcaaagggacgactcaacccattatatagcaacttat
tacgcttcaagcttaaattcaaatggagtttttaaggcacctccacctagtaaaactgac
tcaacatcaaaacaatgtactttggccgatgaaaacaaatttgattgtaatcctgatgaa
cctgttagccaacaagtttgtgaatcaagaggatgctgttgggttcctgttacaataaaa
aaacgtaatgtgcaatctctcaatgtacctcaatgtttctatcctagtgattacaagggc
tatgaaatcgctgatgtgcagcaagaaaaaaacagtgcattgatcaaacttgttcgaaaa
gtcgcctctggcttccctcaagacattagtaatgtcagcgttgagataactggactcgat
gatgaaaggcttcgaattagatttgttgatgctgaaaaggaccgttttgaagttccaatg
ccttttttcaatgtatcagaagcagagcagtttaactcaactctgtacaaaattacaatt
aatcaggatggaaaacttctggtcagccgtacatcaactggaactgtcatatttaatgct
gatctttcaaccttaatttactctgataaatttattcaattgtcagtccgtgttccttct
caatatctttatggtcttggcgaacataaagcttctttcaaaaaagacttgactggttgg
aatcgatatacaatgtttgcccgtgatattggtccaacagaaggtgtcaatctctatggt
tcttatccattttacataatgcctgaagatgatgattcaatgaacgctcacggagtattt
ttacttaatagcaatgctatggatgttataactcaatctactccagctatcacctatcta
actattggtggtattcttgactttttccttttcttgggtccaacggcatcacaagttgct
agacagaacatcaatcttatcggtcgacccgtacttcaaccttactggtctttcggattt
catctttgccgttacggttacgatagtttgaacaaaactcgtgaaacattggaacgaaat
ttagctgtgggaattccaatcgaagcacagtggaatgatattgattacatggaccgtttc
aacgattttacttatgataaagtcaattatgccggtctaggcgattttgtcaaagagcta
cattcaaagaacatgcattatgtcattattttggatcctggtgttagtgctgcagagcca
gctggaacttacccgccatatgacgatggagttaaggctgatatttttgtaaaaaatagc
accgatcaaatttttgtcggcaaggtttggaatcttgtgtccactgtctatcctgatttt
actaatcctgctacaactgattactggaagaaccaattagttaatttgcgaaaggaaatt
gattttgacggtatttggattgacatgaatgaaccatccaacttctacaatggtcaaatt
gatggatgtccgaacgatccttacgaaaaacctccctatgtaccgggtggaactgatctc
aaaaccaaaacactctgtatgaatgcaaaacagtacgctggcattcattacaatgttcat
agtctttacgggctatacgaaaatgttgtcacttataatgctgctctcgatatttttaaa
gctcggccattcattctttctcgttcaacatatccatcgcagggtcattatgcttctcat
tggtctggagatattgaatcatcttgggatcatatgaaatattcaatttcaaacatgctt
gagttcaatgtttatggaatcccaatgattggaagtgatatctgtggtttcgctggaaat
actgaagtagaactttgtatgagatggtcctcgttaggtgctttctacccattctcacga
aaccataatgataaaaataaactcgagcaagatccagccattttaggagaaactgttgtc
gctgcagctaaatatgctttagaagctcgttataaaatgttgccatatctttacacctta
tttgctaaagctaacatgaatggagatactgttgtaagatcgctgtttttcgaatttcct
ttggataaaaatacttattcaattgaaaccgctttcctttggggttcaagtttgtacatt
attccagttctggagcctcaaaaaacgcaagttgatgcttacttcccaaatgagctttgg
tataattttgaggataaaaaactggcattcaacagtactggtgaaagcaagactatacaa
attgataatgacaaaattggtctttttatgcgaggaggatcaattgtacctgtttaccaa
tcttcagcaaacacaaccactgagctgagaaaacaaaaatactatttaaatggctatctc
gacaagtcaggacatgcagttggtgaaatttaccatgatgatggtaaatcaattgacagt
attgaaagtggcatttacattcacgcagattgtaaagctaacaaggatcacctcgtctgc
aattatttgaatatggcaacatttgatgattttaatatcggaggtgttactatttcggga
ctctctgaaaagcctaaaaggataaatctcaatggaaaatctttatccactgacagtttt
actcatgacgattctatactcacgattgagctacctgaagactttaattcttcacaatca
ttttctattgacttcagttattaa

DBGET integrated database retrieval system