KEGG   Tetranychus urticae (two-spotted spider mite): 107361901Help
Entry
107361901         CDS       T04901                                 

Definition
(RefSeq) glutathione S-transferase 1-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00480  Glutathione metabolism
tut00980  Metabolism of xenobiotics by cytochrome P450
tut00982  Drug metabolism - cytochrome P450
tut00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107361901
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    107361901
   00982 Drug metabolism - cytochrome P450
    107361901
   00983 Drug metabolism - other enzymes
    107361901
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tut02000]
    107361901
Enzymes [BR:tut01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107361901
Transporters [BR:tut02000]
 Other Transporters
  Pores ion channels [TC:1]
   107361901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_C_6 Tim29
Motif
Other DBs
NCBI-GeneID: 107361901
NCBI-ProteinID: XP_015784330
UniProt: T1JQA1
LinkDB All DBs
Position
Unknown
AA seq 216 aa AA seqDB search
MVLELYQLPLSSPCRQVLMVGKILNLPFEIKTVHLMEGEHLKPEFLKMNPFHCIPTLVDN
GFALWESRAIMTYLVNKYAPESSLYPKDVKARATVDRWLYWDAGSLYASIFSYYCPIVWQ
KAKPDPANIAPCMDKIKLLDEALAKTKFLCGDTITLADLSCLATITTAKAVDLDISAFKN
VDRWLKELKSNYASWWKELVIDYDKNFRDFLRDCLA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggtcctcgaactgtaccaattacccctctcttctccttgtcgacaagttttgatggtt
ggtaaaatccttaaccttccttttgagattaaaacggtccatctgatggaaggcgaacac
ttgaaacccgaatttctgaagatgaaccctttccattgtatcccaaccttggtcgataat
ggatttgctttgtgggaaagtcgggcaatcatgacttatttggttaacaagtatgcacca
gaaagtagtctttatcccaaagatgtgaaagctcgtgcaactgtagatcgatggctttac
tgggacgctggttcactctacgcgagcattttttcgtactattgtcctattgtatggcag
aaagccaaaccagatccagcaaatatagcaccttgcatggataaaattaagcttcttgat
gaggcccttgcaaagaccaagttcttgtgtggagacaccattactttggctgacctttct
tgtttggctaccataacgactgctaaagctgtagaccttgatatcagcgcatttaaaaac
gttgaccgttggttgaaggaactgaaatcgaactatgctagttggtggaaagagttggtc
atcgactatgataaaaatttcagagatttccttcgagattgtcttgcttaa

DBGET integrated database retrieval system