KEGG   Tetranychus urticae (two-spotted spider mite): 107362728Help
Entry
107362728         CDS       T04901                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00020  Citrate cycle (TCA cycle)
tut00190  Oxidative phosphorylation
tut01100  Metabolic pathways
tut01200  Carbon metabolism
Module
tut_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tut_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tut_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107362728
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107362728
Enzymes [BR:tut01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107362728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 107362728
NCBI-ProteinID: XP_015785335
UniProt: T1KB86
LinkDB All DBs
Position
Unknown
AA seq 655 aa AA seqDB search
MLRLIQKLKLNNVSYFKEIPKNQRRNVHISGEKRKCFPKSAAISKDYPVIDHTFDAVVVG
AGGAGLRAAFGLVEEGFSTAVITKLFPTRSHTVAAQGGINAALGNMEPDDWRWHMYDTVK
GSDWLGDQDAIHYMTREAPHAVVELENYGMPFSRTDDGKIYQRAFGGQSYNFGKGGQAHR
CCCVADRTGHSLLHTLYGQSLRYDCKYFVEFFALDLLMENGECRGVIAVNLEDGTLHRFR
SKNTILATGGYGRAYFSCTSAHTCTGDGTAMVCRAGLPSEDLEFIQFHPTGIYGAGCLIT
EGCRGEGGFLVNSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVYLQL
HHLPAEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGVPTNYKGQVITYDEKN
GDRVVPGLYAAGEAACASVHGANRLGANSLLDLVVFGRACAKTIAEENKPGETIGDLSMN
AGEQSVANLDRIRHSKGTTRTAALRLNMQKVMQNNAAVFRNGEILSEGVKKIDECFEQLP
DIGLNDKGMIWNTDLIESLELQNLMLNARMTLYSAEARKESRGAHAREDFKERIDEYDYS
KPLEGQVKKPFDQHWRKHTLSWITPEGKVVLKYRPVIDETLDEQCQTVPPAIRAY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgattgattcaaaaactcaagcttaataatgtcagctatttcaaagaaattcct
aaaaaccaacggagaaatgtgcatatctctggtgaaaagagaaaatgtttccctaaatca
gcggcaatctctaaagattatccagttattgatcatacatttgatgctgtggtggttgga
gctggtggagctggacttcgagcagcatttggattagttgaagaaggtttctcgaccgct
gtgattactaaattgtttccaactagaagccatacagttgctgctcaaggaggtattaat
gctgctttaggtaacatggaacctgatgactggagatggcatatgtatgatactgttaaa
ggatcagattggcttggtgatcaggatgctattcattatatgacccgagaagctccacat
gcagttgttgagcttgaaaattatggtatgcctttcagtcgaactgacgatggtaaaatt
tatcaaagggcgtttggaggacaatcatataattttggcaaaggtggtcaagctcatcga
tgttgctgtgttgctgatcgaactggacattctctgcttcatacactctatggtcaatca
ttgaggtatgattgcaaatatttcgttgaatttttcgcccttgacttacttatggagaat
ggtgaatgtcgtggtgttattgctgttaatcttgaggatggtacattacacaggttcaga
agcaagaatacgattttagctacaggaggatatggtcgagcctacttttcctgtacatca
gctcatacatgtactggtgatggaacagccatggtttgtcgagctggccttccttcagaa
gacttagaatttatccaatttcatccaacaggaatttatggagctggatgtttgatcact
gaaggctgtcgtggtgaaggaggttttcttgtaaattcggaaggtgaacgattcatggaa
agatatgcacctgtggccaaagatcttgcatctcgagacgttgtcagtcgatctatgact
attgaaattcgtgaaggccgtggttgtggtccagaaaaagaccatgtataccttcaatta
catcatttgcctgctgaacaattggcaacacgacttccaggaatttcagagactgcaatg
atttttgctggtgttgatgtcaccaaagagcctattcccgttcttccaactgttcactat
aatatgggtggagttccaactaattacaaaggtcaagttattacttatgatgagaaaaac
ggtgatagagttgttcctggtctttacgctgctggagaagctgcttgtgcgtcagtacat
ggagctaacagattgggtgctaattcattattagatttagttgtttttggccgagcttgt
gctaaaactattgcggaggaaaacaaacctggagaaacaatcggagatttgagtatgaac
gctggtgaacaatcagtcgctaatcttgatcgtatcaggcattccaaaggaactactcgc
actgcagctttacggcttaacatgcaaaaagtaatgcaaaataatgctgcagttttcaga
aatggtgaaattctttcagaaggtgtaaaaaagatcgacgaatgcttcgaacaactccct
gatattggattaaacgacaaaggtatgatctggaatactgatctgattgaaagtttagag
cttcaaaatctaatgttgaatgctagaatgacactttacagtgctgaagctcgcaaagaa
tctcgaggagctcatgctcgagaagacttcaaagaacgtatcgatgaatatgattattct
aaacctttggaaggtcaagtaaagaagccttttgaccaacattggaggaagcatacatta
tcatggataactcctgaaggcaaagttgtattaaagtatcgacctgtcattgacgagact
cttgatgagcaatgtcaaacagttcctcccgctatccgagcctattaa

DBGET integrated database retrieval system