KEGG   Tetranychus urticae (two-spotted spider mite): 107363840Help
Entry
107363840         CDS       T04901                                 

Definition
(RefSeq) armadillo segment polarity protein
  KO
K02105  catenin beta 1
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tut00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107363840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT_2 Arm_2 Cnd1
Motif
Other DBs
NCBI-GeneID: 107363840
NCBI-ProteinID: XP_015786590
UniProt: T1KGW2
LinkDB All DBs
Position
Unknown
AA seq 541 aa AA seqDB search
MSFSNFTTKIPEIQATDSGFSSAAPSIIDDEFLASFDFNYEGKSSHTLPPFQSTPEPMSP
VPMLDVQTSSDVASQAIPTLIDLLSDEDPFIQNKACNMVLQLSTEKVSRETIINSPGMIV
ALLEALSKTNDIEIIENGVGILYNLSEHRQGRLTIYKLGGIFELVRMLSCNSESVVHLAI
TALHLLLLHQEGSKEAVRDANGLPPLISLLQNQNEQFLSIVTDCIRLLVYGDSESKIIMQ
RLGGTTQLLQILQTVSYPNLLWVISNTLKVLSACQENKRTIIENGGLQALAMHLNTQLDS
HVSNCLFTIRNLSDAAVFQNDLHLLLSNTMDILRFALTDQVTQENIITCVAGILSNLTCN
VINKQIVRQMGGVELLIGTVIKFGSKEEITEPAICALRHLTCRYIEAELASNAILDCEGL
GPIISLLKTNSWPLKKAVVGLLRNLALLDANIVPLRDHYAIENLAEVLNEAKIASRSVDL
GAGVVPMDAPLIPDPKIEAIIEEAAATLKIMAKDPLSKHKIQEKSFFFEEFIVDIFNTSI
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttcaaattttacaactaaaattcctgaaattcaggcaactgattctggattt
tcatcagcagctccatccattatagacgatgaattcctggcttcatttgactttaattat
gagggtaaatcatcccataccctacctcctttccagtccacacctgagccaatgtccccc
gttccaatgctggatgttcaaacaagctcggacgtcgcatctcaagctattcctacattg
atagatcttctttcggatgaggatcccttcatccaaaacaaagcctgtaatatggtgctt
cagttatctactgaaaaagtcagtagagagacaataattaattcacctggcatgatagtc
gcccttttagaagctctttctaaaacaaatgatattgaaattattgaaaatggcgttgga
attctttataatctttcagaacatcgtcagggtcgactaacaatttataaacttggtggt
atttttgagctggttcggatgcttagctgtaatagcgagtcagttgttcatcttgctatt
acagctctccatcttctacttttacaccaagagggttctaaagaagccgtccgtgatgct
aatggtctccccccattaatttctttgttacaaaatcaaaatgaacaatttttatcgatt
gttacagactgtatccgtcttttagtatatggagactcggaaagtaaaattataatgcaa
agacttggtggcaccacacaactacttcaaattttacaaactgtttcctacccaaatctt
ctctgggtaatttccaataccttaaaagttctgtcagcttgtcaggagaataagcgaaca
attattgaaaacggaggattgcaggctttggccatgcatttgaacacacaactagattcc
cacgtatctaattgtttgttcactattcgcaacctttccgatgcagcagtgtttcaaaat
gatcttcatcttttattatctaacacaatggatattcttcgttttgctcttaccgaccaa
gttactcaagaaaacataatcacttgtgttgcaggcattttgtcaaacttaacttgcaac
gttattaacaagcaaattgttcgccaaatgggtggagtcgaattgctaatcggaactgtc
atcaaatttggctcaaaagaagaaatcaccgagcctgcaatttgcgctcttcgacattta
acatgtcgatacattgaagctgagcttgcatctaatgcaattctggattgtgaagggctt
gggcctataataagtcttttaaagactaacagttggccattgaaaaaagccgtcgtgggc
ttactacgaaacttggctttacttgacgcaaatatcgttccactacgtgatcactacgcc
attgaaaatcttgctgaggtcttaaatgaagcaaaaatcgcctcacgatctgttgattta
ggagcaggagtagtgccaatggacgcacccctaataccagatccaaaaatcgaggcaatc
attgaagaggctgccgcgacgctcaaaataatggccaaagaccctcttagtaaacataag
attcaagaaaaatcttttttctttgaggaatttatcgttgacatctttaacacatctatt
aattga

DBGET integrated database retrieval system