KEGG   Tetranychus urticae (two-spotted spider mite): 107365534Help
Entry
107365534         CDS       T04901                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZH2
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107365534
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tut03036]
    107365534
Enzymes [BR:tut01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107365534
Chromosome and associated proteins [BR:tut03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107365534
   Polycomb group proteins
    PRC2-EZH2 complex
     107365534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET RAP-1
Motif
Other DBs
NCBI-GeneID: 107365534
NCBI-ProteinID: XP_015788543
UniProt: T1KMP5
LinkDB All DBs
Position
Unknown
AA seq 819 aa AA seqDB search
MQELVDKSDDSSNSSVVLLETISNGDPDLTLLATELQRFIRSEWTKTRSRTRYRRKDVIK
NCYINNRKELKRLHASHPPQSVSVNYKFSTYENPSMIAKTMLVDFSDGKKTNVFIKQMHF
VKQIPTMFIWAPIQQNYLVADEQELHNIPYLGDEVIDNENNFIVDLLNNYNGKVHGDGET
NNFEDEPFFELVDNLSQKMDQVELLEPLLKEVRSLKPSTLAEKEKEYPPFKVFEAISFAF
PERGSPEELRLKYLDIMRRKDRIRIMPLETTPNIDGPNAVSTSREQTMHSFHTLFCRRCY
KYDCFTHQVGSVKPRCRYTKMKPDTTPCGDDCYLHFESVKIKIKQESEEEARKQELPERP
IVKKVFSVESNGSSGNDASSEDSNDSSASIKMRKGPNHILTSRSSSETRRLRAPSYSSLS
SEGQDLNGKDECDKNNSVQVNGNTTNSEGYTNGQTNGNANGKTNGKTNGKEEDSVEESMK
SESEAVNNCSDLDDSPIDMGSWTGSEKSLFRALWNAYYKNYCAIAEAIFTKTCAQVYLFA
QQEWEEFVVDEVSKETTTTPKKKKKRSNSLYHRNKTSRRSFTKNGRPHVNVDNYVPCDHP
GQSCDSRCVCVSTNNFCEKYCNCSLDCPNRFPGCRCKGQCNSKQCPCFNAIRECDPDLCQ
SCGADSFDEPNISCKNVSIQRGMKKHLLLAFSDVEGWGIFLKDSAHKNELISEYCGEIIS
QDEADRRGKVYDKYNRSFLFNLNNEFVVDATRKGNKIRFANHSVNPNCFAKVMMVNGDHR
IGIFARRNIEPGEELFFDYRYGLSEQLKFVGIERDIILA
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagcttgtagataaatccgatgattcaagcaactcctctgtcgttttattggag
actatttctaatggagatccagacttgactcttcttgccaccgaactccagcgattcatt
cgttctgaatggaccaaaacaagaagtagaacgcggtacagaaggaaagatgtgattaaa
aattgctatattaataatcggaaagaactgaaacgtttacatgcatcgcatcctcctcaa
tctgtttcagttaattacaagttttctacttatgaaaatccttctatgatagcaaaaaca
atgctggttgattttagtgatggaaaaaagacaaatgtatttattaagcaaatgcatttt
gtcaaacaaattcctaccatgtttatatgggctccaatccagcaaaactaccttgtggca
gatgagcaggagcttcataatattccttatctcggtgatgaagttatcgacaatgaaaat
aattttatagttgatcttttgaacaactataacggtaaagtgcatggagatggagagact
aataattttgaagatgaaccgtttttcgagttagttgataatttatctcaaaaaatggat
caggttgaactcctggaaccacttctgaaagaagttcgctcacttaagccatctacttta
gcagaaaaggaaaaagaatatccacctttcaaagtatttgaagctatttcctttgcattc
cctgaaagaggctcacccgaggagctccgtttaaagtatcttgatatcatgagaagaaaa
gatcgtattcgtattatgccattagaaactactcccaacattgatggtccaaatgctgtt
tctacgtcacgggagcaaactatgcattctttccatacacttttttgtcgccgttgttat
aaatatgattgttttacacaccaggtaggatctgttaaaccaagatgtcgttatactaag
atgaaacccgacacgactccctgtggagatgattgttatttacatttcgagtctgtcaaa
ataaaaatcaagcaagaatccgaggaggaagctaggaaacaagagctacccgaaagaccg
atagttaagaaggttttttctgttgaatccaatggaagtagtggtaatgatgctagcagc
gaagatagcaatgatagctctgcttcgattaaaatgagaaaaggtccaaatcatatccta
acttctagatcgagtagtgaaactagaaggctacgagctccaagctattcttcactatct
agtgaaggtcaagatttaaacggcaaagacgagtgcgataagaacaactcagttcaagtg
aatggaaatacaactaactctgagggttatacaaacggacagaccaatggaaatgccaac
ggaaagaccaacggaaagaccaacggcaaagaagaagacagtgtggaagagtctatgaaa
agtgaatcggaagcggtgaacaattgctcagatcttgatgattctcctattgatatgggt
agttggactgggtccgaaaaatcattgttccgtgctttatggaatgcttattataaaaac
tactgtgctatagctgaggccatatttacaaaaacttgcgctcaagtgtatctttttgct
caacaggaatgggaagagttcgttgttgacgaggtttccaaagagacaaccacaactcca
aaaaagaagaaaaagaggagtaattcactttaccatagaaataaaacatctcgtcgatca
tttaccaagaatggtcgaccccatgtgaatgtggacaattacgttccgtgtgatcatcct
ggtcaatcatgtgatagcagatgtgtatgtgttagtacaaacaacttttgtgaaaaatat
tgtaattgtagtcttgactgtccaaatcggtttcccggatgccgatgtaagggccagtgt
aattctaaacaatgtccctgtttcaatgccattcgtgaatgtgatccagacttgtgccag
tcttgtggagcagattcttttgacgaaccaaacatttcttgtaaaaatgtttcaattcaa
cgaggaatgaagaaacacttattgcttgccttctcagatgttgaaggttggggaatcttt
ttaaaagactcagctcacaaaaatgaacttatttccgaatattgtggggaaattatatct
caagatgaggctgatcgtcgtggtaaagtttacgacaagtataatcgaagtttcttattc
aatttaaataatgaatttgtcgttgatgctacccgaaaaggaaataagattcgctttgct
aatcactcagtaaaccctaactgttttgccaaagtaatgatggtcaatggagatcatcgt
attggtatatttgccaggagaaacattgaacctggagaagaactattctttgactacaga
tatggattaagtgaacaattgaaattcgttggaatcgaacgtgatattattttagcgtaa

DBGET integrated database retrieval system