KEGG   Tetranychus urticae (two-spotted spider mite): 107366097Help
Entry
107366097         CDS       T04901                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00020  Citrate cycle (TCA cycle)
tut00190  Oxidative phosphorylation
tut01100  Metabolic pathways
tut01200  Carbon metabolism
Module
tut_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tut_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tut_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tut00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107366097
  Energy metabolism
   00190 Oxidative phosphorylation
    107366097
Enzymes [BR:tut01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107366097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9
Motif
Other DBs
NCBI-GeneID: 107366097
NCBI-ProteinID: XP_015789155
UniProt: T1JTX0
LinkDB All DBs
Position
Unknown
AA seq 299 aa AA seqDB search
MNSVINLFTKNGKLLSLASTSHLPSVRITSTSNNQAAAAAAAAATSEVPEKRIKKFMVYR
WNPETPEVKPYMQTYEVDLNTCGPMVLDALIKIKNELDPTLTFRRSCREGICGSCAMNIG
GGNTLACISRIDTSVEKPMKIYPLPHMYVVKDLVPDMNHFYEQYRSIQPWLQKKDETGFG
KKQNLQSVDDRKKLDGLYECILCACCSTSCPSYWWNSDRYLGPAVLMQAYRWVIDSRDES
TEKRLDQLRDPFSLYRCHTIMNCSRTCPKNLNPGRAIGELKKLLAGWSKKSEPQISGQV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaattcggtcattaacttgtttaccaagaatggtaagttgctttccttggcttcaacc
agccatttaccttcggtaagaataaccagtacatcaaacaatcaggctgccgctgctgca
gctgctgctgctacctctgaggtacctgaaaagcggattaaaaagttcatggtctatcga
tggaatcctgaaacacctgaagttaaaccctacatgcagacatatgaggttgatctaaat
acatgcggtcctatggtgcttgatgctttgattaaaatcaaaaatgaattggatcctact
ttgactttcagacgatcttgcagggaaggtatatgtggttcttgtgctatgaatattgga
ggtggtaatactcttgcctgtatcagcagaattgacaccagtgtcgaaaaaccgatgaag
atctatccattacctcatatgtatgtggttaaggacttggttcctgatatgaaccatttc
tacgagcaatatcgatcgattcagccttggctacaaaagaaagatgaaactggttttggt
aagaaacaaaatcttcaaagtgttgatgatcgtaagaaacttgatggtctatatgaatgt
atattatgcgcttgttgttcaacatcttgtccaagctattggtggaatagtgaccgatac
ttgggacctgctgtactcatgcaagcataccgatgggtaattgattcaagagatgaatca
actgaaaaaaggctggatcaattgagggatcccttctcactttatcgatgtcatacaatc
atgaattgttccaggacctgtcctaagaacttgaatcctggtcgagcaatcggtgaactg
aagaagcttctcgcaggctggtctaagaagagtgagcctcagatatctggacaagtctaa

DBGET integrated database retrieval system