KEGG   Tetranychus urticae (two-spotted spider mite): 107366193Help
Entry
107366193         CDS       T04901                                 

Definition
(RefSeq) fatty acid synthase isoform X1
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00061  Fatty acid biosynthesis
tut01100  Metabolic pathways
tut01212  Fatty acid metabolism
Module
tut_M00082  Fatty acid biosynthesis, initiation
tut_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    107366193
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tut01004]
    107366193
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tut04147]
    107366193
Enzymes [BR:tut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     107366193
Lipid biosynthesis proteins [BR:tut01004]
 Fatty acid synthase
  Animal type
   107366193
Exosome [BR:tut04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107366193
  Exosomal proteins of breast milk
   107366193
  Exosomal proteins of colorectal cancer cells
   107366193
  Exosomal proteins of bladder cancer cells
   107366193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KR ketoacyl-synt Ketoacyl-synt_C KAsynt_C_assoc ADH_zinc_N_2 ADH_zinc_N Thioesterase PS-DH PP-binding adh_short
Motif
Other DBs
NCBI-GeneID: 107366193
NCBI-ProteinID: XP_015789259
LinkDB All DBs
Position
Unknown
AA seq 2300 aa AA seqDB search
MSKGEIVISGISGRWPKSDNLDEFWENLKQSKPMYEKEDFPYSKFFPVTSLAKGSLKNAR
LFDAQFFGYSDRDAADLDAQFRILHETVYESLWDAGIQPDDWRSTRTGFYVGSFTDDADT
VVNPDKRVDFIQLLASRIPYAFDFIGPTLQVDTACAASLTALHEAYLALKRGQCERAIVA
GVAVHQRFGINIEGRELDVLSKSGKSRCLDVDADGYVRCEAVISLVLQWSSQAKRTYATI
LGSSTNADGYKVTGITAPGAATQAILMRTALSAASIDPMDVDYIEGHITSTQAGDVAECE
SILEAYRGNSDKPITVGCVKSFIGHSEGASGLTAVAKVVKIFQNKLIPADIGLTNPNPKI
AGLFDGRLVPVSKPINFTGKYIGINSFGYGGANAHVIVTCNAPEYKSNNSVSHNGYRLVC
FCNRTMEGIDKMINWLQHEPKATRSDCLSLLDDLATIKPSTGMVARGYVILNKQQAIIAQ
DKAIVTQMESTLTVSLDASLKNYLKTLTAFKPFKNSIDASIKCLKKSDVSDLSPDSLVIL
TFIGIIDLLKSLNLSFNLLDCNLAYQQAVIKYLEGKLSRNEIISSTMKEMQLNGKLKQTN
KSHEDRSSTVKVSSSPPQSSSSVMLNLGSNLILSQNGNIIFQSSNLNEPNLWLEAFHSAL
GTVYLLGCQIRLSSLYPTYNYPVSRDCPSLAGLISWSHTVQYPTIDRFNHYADLPKKTDH
KIDLLDPEYFSVSDHIIDDRVVFPATGYIHLIRKHLSSIYLGAFMDPFDVSFRVWNVTIN
RAVFITDPIVFTVVYDPDSKAFEIITSGNIIATGSASLLDLSSWSAQERDDYRYNKTIES
EDMELNREEFYQEMTILGYRYQSSYQNVSSVKIVRSSAVLSYTKNWMALADCFFQLEAFW
SNERKLLVPTKISELRFDADLFKSHLTSEQEFIKVYSTRPGLIGTSGLIIDGMEVKEFPI
KGQKDRLRIGQQAFTPFDSLIDVDEQLVKLRTRYCEFNAKLLQKDVSHIDLEEIKTLSES
IPAEYNQNILKLQKNPLNILNRVDFFLNELKDNQNENIFDDLITLIPADCVHPLIDLVAD
NNRKEAKITIQNYAFSSQMLKKYIQQQFSAIGKNCVFVDGKTDKLNKPADSKPGTEMTLT
VYKHKSLDLMAGSLYSDYCESSIVSTMRGKFCLILTREKLTSTEEQLADVCQLKIEVDPS
ISTKLSGLMEKSNYIQIGSTFCKETGLRCILYRRKPTDLTKPHRIIKINGSSDCSWFDEI
KKTVDNSINDISRLWLVADDSYQNGILGLASCLALEPELNKIRCIFTPGKSFNETDLTQS
LIDRDLLINTCLDGVWGFHRISVLSPEKEQRFTTSEYVYLKSISRSVQWLQDDTLITDLK
NNPSLANELITVAYSSINFRDVMVANELMPPNAYPHKLLFRLGMEFSGYSATGQRIMGIV
GGNGFASFIDPKSSPFLFTLPVPDSWSLAQAATVPICYGTVIYALIMRGKLEPGETVLIH
AGSGGVGLAAISICLSLGCKIFTTVSSAKKRKMVQRMFPQLTDDCFADSRSTSFEEYILR
KTNGRGVDVVLNSLIREKLDAGLQVLADHGRFLDLSKVDIYADKKIEKNVFEPLFSDQTI
LRPNIAIHSICLATFLFSKKANEVDRLTRIFMDGMADGSVIPLPYKTYNHSEVSTAFSDM
MSAKHIGKLIVEVRGESNPTTNHSTQDNKSMLEKPGFSIPCLKQTIFDSEKVYMIIGGLG
GMGLEMALWMVERNVRKLVITSRSGIKTNYQRYVIRKIKSVPNTRVEISRLDASHYKSAI
RLIREASRLGPIGGIFNLAVVLRDGLFQNQTLDAFKTVCLPKIEITRNLDILSRENCKHL
DYFVTFSSIASLGNLGQSNYGYANSFMERLCENRRKDGLPGLAIQWGPVDDVGIAVRTLG
EKKSVGGFEPQRIRSCLEMLNFFLGSTVSVAFSAIPVVENEQSDPQDALLRVSRILGVKD
IRVINLKLRLRDLGMDSVQAIEVREYLENTYNLSFAAASIYDLTLENLVKIAAVEISSVE
EEFKDLDKIFRPLKTTGPRPVFFFPPAIFDFLGMLPLARGLERQVFGIDFTDDADIVKSW
ETLTDYYCARILEQWPSEPSYDFVSYSLGAAFAFEVGRKIQSIRGPNAVNRIVFIDSTPF
GIQQALSWSTKIAEKVGNVHIDKETLLAFLRRMDRKQGNSWRSRVYKTTQQASSSDLMED
VLFSKYQYISQMKIEPRLKADALFFKCKHAISAFEGSITVSLDKSIDGNIKTIMLDSNHA
EVINQCKDLLIAECNAFLAV
NT seq 6903 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaggagaaattgtcatctctggaatttccggtcgatggcctaaatcagataat
ttagatgagttctgggaaaatttaaagcaatcgaaacccatgtatgaaaaggaggatttt
ccatattcaaaattttttcctgtcaccagcctagctaaaggatctttaaaaaatgctaga
cttttcgatgctcaattcttcggatattccgatcgtgatgctgctgatcttgatgctcaa
ttcagaatcctccatgaaaccgtctacgaaagtctttgggacgcaggaattcaaccagat
gattggaggtcaacacgaactggattttatgttggatcatttaccgatgatgctgacaca
gtggttaatcccgacaaacgtgttgactttattcaattactggcgtccaggattccatac
gcatttgatttcattggtccaactcttcaagttgacacggcttgtgcagcatctctaacc
gctctccacgaagcttacttggctttgaaaagaggacaatgtgaacgagctattgtagcc
ggtgtagctgttcaccaaagattcggtatcaacatcgaaggaagagaactggatgtgctt
tcaaagtcaggtaaatcgcgatgtcttgatgttgatgctgacggttatgtcagatgtgaa
gcagtaatttcacttgtactccagtggtcgtcacaagctaaacgaacctatgcaaccata
ttgggtagttcaacaaatgctgatggctataaagtgaccggtatcacagctcctggagca
gcaactcaagccatcttaatgagaacggccctgtctgcggcatcaattgaccctatggat
gttgattatattgaaggccacataacatcaactcaagctggtgatgttgctgaatgtgaa
tctatactagaagcttatcgaggaaatagcgataaaccaattactgttggatgtgttaaa
tcatttataggccattctgaaggagcttcagggttaactgctgtggctaaagtggtgaaa
atatttcaaaataaactaattcctgctgatattggtttaaccaatccaaacccaaagatc
gctgggttatttgatggtagattggttccagtatccaaacccatcaattttactggaaaa
tatattggaatcaactcatttggatatggtggtgctaacgctcatgtaattgtaacctgc
aatgctcctgaatacaaatcaaacaattctgtttcgcataatggatatcgattggtttgc
ttttgtaatcgaaccatggaaggaatcgacaagatgattaactggctacaacatgaaccg
aaagcaactcgatctgattgtctgtcattgttggatgatcttgcaacaattaaaccctcg
accggaatggttgctcgaggttatgttatacttaataaacaacaagctattattgctcag
gataaagcaattgtgacccaaatggaatcaacattgactgtttcacttgacgcttcgcta
aaaaattatttaaaaacgttaactgctttcaaaccgtttaaaaactctattgatgcttca
attaaatgtctcaagaaaagtgatgtttctgacttatcacctgattcgctggttatttta
acttttattggaattatcgatctgcttaaatcgttgaacttatcatttaatttacttgat
tgtaatttagcttatcagcaggcagtaatcaaatatctagaaggaaagttgtcccgaaat
gaaataatcagttcaacaatgaaagaaatgcaattgaatggaaagttaaaacagaccaac
aaatcacacgaagatcgttcgtcaacagttaaagtatcttcttcacctccacaatcatca
tcatcggtgatgttaaaccttgggtcaaatctaattttgtctcaaaatggaaacattata
ttccaatcttcaaatcttaatgaacccaatctttggttagaagcctttcattctgccttg
ggaacagtttatcttcttggttgccaaattagattgtcttcactgtatccaacctacaat
tatccagtgtctcgtgattgtccatcattagcaggtttaattagctggtcacatacagtt
caatatccaaccattgatagatttaaccattatgctgatttacccaagaaaacagatcat
aaaatcgacttgttggatccagaatatttctctgtcagtgatcacattatagatgatcga
gtagttttcccagctactggatacatccatttgattcgtaaacatttatcttcaatttac
ttgggagcattcatggatccgtttgacgtttcattcagagtgtggaatgttacaatcaac
cgagcagttttcatcactgatccaatagttttcacagtagtctatgatccagacagtaaa
gcttttgaaataataacttcaggaaatattattgccactggatcagcttcacttcttgac
ttaagctcttggagtgcccaagaaagagacgattatcgttataataaaacaatcgaaagt
gaagacatggaattaaatcgtgaagagttttaccaagaaatgactatattgggttatcgt
tatcaatccagctatcaaaatgtttcatcagtaaaaatagttcgatccagtgctgtcctc
agttatactaaaaattggatggcgttagctgattgtttctttcaactggaagctttctgg
tcaaatgagagaaaattattggtaccaacgaaaatcagtgaattacgattcgatgctgat
ttatttaaatcacacttaacatccgaacaagaatttattaaagtctattctactagacct
ggtttgattggtacaagtggtctgatcattgatggaatggaggtgaaagaatttcctatc
aaaggtcaaaaggatcgattacgaatcggtcaacaagcatttactccctttgatagtttg
attgatgtcgatgaacagttggttaaactgaggacaaggtattgcgagtttaatgcaaaa
ttattacaaaaagatgtatcacacattgatttggaggaaattaaaactctttctgagtca
ataccagctgaatacaaccaaaatattctcaaactgcaaaaaaatcctttaaatatccta
aacagagttgatttctttctcaatgaattgaaagataatcaaaatgaaaatattttcgat
gatttgattaccttgataccggctgattgtgttcatcctctaattgatttggttgcagac
aacaatcggaaagaagcaaagataacaattcaaaattatgcttttagctctcaaatgttg
aaaaaatatattcaacaacaattcagtgcgattggtaaaaactgtgtctttgtggatgga
aaaactgataaattaaacaaacctgctgattctaaacctggaactgaaatgaccctgact
gtctacaagcataaatcattagatttaatggctggctcactatattcagattattgcgaa
tcttcaattgtgtctacaatgagaggcaaattttgtctaattttgactcgagaaaagcta
acctcgacagaagagcaacttgctgatgtttgtcagttaaaaattgaagttgatccatca
atatccacaaaactgagtggattaatggaaaaatcaaattatattcaaattggatcaact
ttttgtaaagaaacaggtttaagatgtattttataccgacgtaagcctacagatttaacc
aagcctcatcgtataattaaaataaacggttcatctgattgctcttggtttgacgagatt
aagaaaactgttgacaattcaattaatgatataagtcgcctttggctggttgctgatgac
tcttatcaaaatggtatacttggattagccagttgtctcgcattagaaccagagttgaat
aaaattcgttgtatatttactcctggcaagtcttttaatgaaacggatctaacccaatct
ttgattgaccgcgatttattgatcaacacttgtctggatggagtttggggttttcaccgc
atttccgtcttatcacctgaaaaggaacaaagattcactacttcagagtatgtttacttg
aaatcaatttccaggagtgttcaatggctacaagatgatactttgattacagacttgaaa
aataatccatcgctagctaatgagctaattacagttgcctattcaagtattaactttcgt
gatgttatggtagcaaatgaactgatgccacccaacgcttatccccataaactacttttc
cgcttaggaatggagttttcaggctattcagccaccggtcaacgaataatgggaattgtt
ggtggtaacggtttcgcaagcttcatcgatccaaaatcttcaccatttttgtttactctc
ccagtacccgattcttggtctttggctcaagcagcaactgtacccatatgttatgggaca
gttatctatgctttgattatgaggggaaaattagagcctggagaaactgtactcatccat
gctggttctggtggtgttggtcttgcggcaatatccatttgtttgtctcttggctgtaaa
atatttacaactgtttcctcagctaaaaagcgaaagatggttcagcggatgtttccacaa
ttgactgatgattgctttgctgattctcggagtacttcttttgaagagtatatcttgcgt
aaaaccaatggtcggggtgttgatgttgtcctcaactctttgattcgtgaaaaactggac
gctggtttacaagtgttggctgatcatggacgtttcctagatttatccaaggtcgatatt
tatgcagacaaaaaaatagaaaaaaatgtttttgaacctctgttctcagaccaaacaata
ttacggcccaatatagcaatccactctatttgtttggcaacatttttattttccaagaaa
gctaatgaagttgatcgcctcactcgaatatttatggatggaatggctgatggttcggtc
attcctttaccttacaaaacatataatcattcagaagtatctactgctttcagtgacatg
atgtctgccaaacatattggcaaattaattgtagaagtgcgcggtgaatcaaatccgacc
actaaccattcaacacaagataacaaatcaatgctcgaaaaacctgggttttcaatccct
tgtttaaaacaaaccatttttgattcagaaaaggtttacatgattattggtggtttggga
ggaatgggtcttgaaatggcactttggatggttgagcgaaacgttcggaaattagttatt
acctcaagatcggggattaaaacaaattaccaacgatatgtgataagaaagataaaatct
gttccaaatacaagggttgaaataagccgtttggacgcatctcattacaaatcagcgatt
cgattgattagggaggcctcaagattgggtcctattggtggtatttttaatctagcagta
gttcttcgtgatggtctttttcaaaatcaaactctcgatgcttttaaaactgtctgtttg
cccaagattgaaataactcgaaatttggatattttaagtcgtgaaaactgtaaacatctc
gattattttgtcactttttcatccattgcttctcttggtaatttgggacaatctaattat
ggttacgctaacagttttatggaaagattgtgtgaaaatagacggaaagatggactacca
ggattagctatccagtggggtccagtagatgatgttggtattgctgttcgtactttaggt
gaaaaaaaatctgtaggtggctttgagccccaaagaatacgatcatgtctagagatgttg
aactttttccttggatctacagtctctgtagccttttcagccattccagtggttgagaat
gaacaaagtgacccacaagatgcattgcttcgtgtctcacgaatcctaggggttaaagat
attcgagtaataaacttgaagcttcgccttcgtgatcttggtatggactcagtgcaagca
attgaagtcagagaataccttgaaaatacttacaatttatcctttgcggctgcatcaatc
tatgacttgactcttgaaaatttggttaaaattgctgctgtagagataagttcagttgaa
gaggaattcaaagatttagacaaaattttcagaccgctcaaaacgactggtccaaggcct
gtcttcttcttcccgcctgcaatatttgatttccttggtatgcttcccttggctcgaggt
cttgaacgtcaagtttttggcattgatttcactgatgatgcagatatagttaaaagctgg
gaaactcttactgattactattgtgcacggattttggaacaatggccatctgaaccaagt
tatgatttcgtctcttattcacttggagctgcgtttgcttttgaggtgggccgaaagatt
caatcgattcgcggtccaaatgcagtcaatcgtatcgtcttcattgattcaactcccttt
ggtatacaacaagcgctctcatggtcaaccaagattgctgaaaaggttggcaacgtacat
atcgataaagaaactttacttgctttcctcaggcgtatggaccgaaaacagggtaattca
tggcgatctcgagtttacaagactactcaacaggcatccagctctgatctcatggaggat
gtattgtttagcaagtatcaatatatttctcagatgaaaatcgagcccagattgaaagca
gatgctctcttcttcaaatgtaaacatgctatttcagcattcgaaggaagtattactgtt
tcccttgacaagtcaatcgatggcaatatcaagaccataatgttggactctaaccatgcc
gaagtgataaaccaatgtaaagatttactaattgccgagtgcaatgcatttcttgctgtt
tag

DBGET integrated database retrieval system