KEGG   Tetranychus urticae (two-spotted spider mite): 107366872
Entry
107366872         CDS       T04901                                 

Definition
(RefSeq) uncharacterized protein LOC107366872
  KO
K20017  Bcl-2 family protein
Organism
tut  Tetranychus urticae (two-spotted spider mite)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 107366872
NCBI-ProteinID: XP_015790002
LinkDB
Position
Unknown
AA seq 361 aa
MNVPRDEVRYRRGTAVGPFIPSHNLLKIPTNMQRKSSLPIIAPLRSDSLSTSTSLSTKSS
PLLDLPIHFSSGKSSSLSPASSSSSFLSTNYNTSVNSVNVSSKNYYSSYYDRTFGANCSS
ADDDEFEDEDSSPDTILIESGKRLSAVGLAFGQHLQTMALKFSTNHKDIIDKTRILCARH
VRTKLSKSGLIDKRSSLTKLRSMSNIDFDPLLVDLMDSISDLITEMDRRSPGLFDSAIKR
SGANVSILSSPEKASFALTVILDEIFIDSISWPKIAAMFGVTGALAVDCATKGKQEYITS
LVDTVGNYTENNLARWIHNQGGWSSLIYCYNKESSWSRPVQYLALITFFFILILSIIWFK
F
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaatgttcccagagacgaggtgaggtaccgtcgtgggacggctgttggtcccttcatt
ccaagtcacaatctgttgaagataccaaccaatatgcagcgaaagtctagtttaccgata
attgcgccacttcgatctgacagtttgtcaacatcaacatcattgagcacaaaatcatcg
cctttactggatctgccaatccacttctcatctggtaaatcatcctctttatcaccagca
tcatcatcatcttcattcttatcaacaaattataacacaagtgtcaatagtgttaacgtt
tcttctaaaaattattattcttcctattatgatcgaacatttggtgccaactgttcaagt
gctgatgacgatgaatttgaagacgaagactcgtcacccgatacaattttgattgaaagc
ggtaaaaggttgagtgctgttggccttgctttcggtcaacatctccagacgatggctctc
aagttttcaaccaaccacaaggatataattgataaaacacggattctctgtgctcgccat
gttcgcaccaaattatctaaaagtggtttaatcgataaacgttcatctttaactaaactt
agatcaatgagcaacattgactttgatccactgctggttgacctgatggactcgataagt
gatttaataactgaaatggacagacgatctccaggtttgtttgactcggcaatcaaaaga
tcgggcgcaaatgtgagcattttatcgtcacccgagaaagcctcgtttgctttgacagta
attttggatgaaattttcatcgactcaataagttggccaaagatagcagccatgtttggt
gttaccggtgctctggccgtcgattgtgccaccaaaggaaagcaagaatacataaccagt
ttggtggatacggttggcaattacaccgagaataatctagctcgatggattcacaatcaa
ggtggttggtctagcttgatttactgttacaataaagaatcttcatggtctcgtcctgtt
caatatttggctttaattacattcttttttattctcattttaagcataatctggttcaaa
ttttaa

DBGET integrated database retrieval system