KEGG   Tetranychus urticae (two-spotted spider mite): 107367269Help
Entry
107367269         CDS       T04901                                 

Definition
(RefSeq) hexokinase-2 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00010  Glycolysis / Gluconeogenesis
tut00051  Fructose and mannose metabolism
tut00052  Galactose metabolism
tut00500  Starch and sucrose metabolism
tut00520  Amino sugar and nucleotide sugar metabolism
tut01100  Metabolic pathways
tut01200  Carbon metabolism
Module
tut_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tut_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107367269
   00051 Fructose and mannose metabolism
    107367269
   00052 Galactose metabolism
    107367269
   00500 Starch and sucrose metabolism
    107367269
   00520 Amino sugar and nucleotide sugar metabolism
    107367269
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107367269
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tut04131]
    107367269
Enzymes [BR:tut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107367269
Membrane trafficking [BR:tut04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107367269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 107367269
NCBI-ProteinID: XP_015790448
LinkDB All DBs
Position
Unknown
AA seq 454 aa AA seqDB search
MSYSIELSKIEAITRNLVLTNDQLEKVASLLLNEFNEGLGKQTHPSASVKMFPTYVRDVP
NGRGKYEEGKFLALDLGGTNFRVLLIDINGDAFHMENEIYAIPQEIMLGTGEQLFDHIAS
CLSQFVEKRNMKNCRLPLGFTFSFPCIQEGLIRARLVQWTKGFKCAGVEGRDVVQLLRDA
IKRRSDVDIDVMAVVNDTTGTLMSCAHKNRECRVGLIVGTGTNACYMETLDNVELWNEEI
DDPRQVIVNTEWGAFGDNGVLDFIRTKWDEEIDVNSLNPGKQLFEKMISGMYMGELCRVI
LADLTRRGLIFEGEGSEKLFTPWGFKTAYISFIESDSKHSYTETRKALEELDLTNVSNED
CEALKLVSARVSTRAAYLVSAAVATILNKIRRPHTTVGVDGSVYRYHPHFHDLMERKIAD
LVHPEYKFDLMLSEDGSGRGAALVAAVAVRQPTR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtcatattccattgagctttccaagattgaagccatcacccgtaacctagttttaact
aatgatcaacttgaaaaggttgcttctctccttttaaatgaattcaacgaaggactcgga
aaacaaacccatcctagcgcctcggttaaaatgttccccacttatgttcgcgatgtgcct
aacggacgtggtaagtacgaggaaggtaaatttttagccttggatctcggtggaactaac
ttcagagtccttctaattgacattaatggtgacgcgtttcatatggaaaatgaaatctat
gctataccacaggaaattatgcttggaaccggcgaacagttatttgatcatattgcatcc
tgcctttctcaatttgttgaaaaacgtaacatgaaaaattgccggcttccacttggtttc
accttcagtttcccgtgtattcaggaaggcttaatccgagccagacttgttcaatggact
aagggtttcaagtgtgctggagttgaaggaagagatgttgttcaactccttcgtgatgcc
atcaaaaggcgatcggatgttgacattgatgttatggccgttgttaatgataccactgga
actttaatgtcatgtgctcacaaaaaccgtgaatgtagagtaggattgatagtaggtact
ggaactaacgcatgttatatggaaactctcgataacgttgaactttggaatgaggaaata
gatgatccacgtcaagttatagtgaatactgaatggggtgcattcggtgacaacggagtg
ttagatttcattcgaacgaaatgggatgaagaaatcgatgtcaattccctcaatcccgga
aagcaattatttgaaaagatgatttctggaatgtatatgggtgaactttgtcgagttatt
ctagccgatttaacacgcagaggtctcatttttgaaggagaaggatcagaaaagttgttc
acaccctggggcttcaagacagcctacatttcattcattgaaagtgactctaaacacagt
tatactgaaacacgtaaggctcttgaagagcttgatttgactaacgtttcaaacgaagac
tgtgaagcattaaagttggtctcagcacgagtttcaacaagagcagcatacttagtgtct
gcggctgttgcaaccattctcaacaaaattcgtcgacctcacacaactgttggagttgat
ggttcagtgtatcgttatcatcctcacttccatgacttgatggagagaaaaattgctgac
cttgttcatccagagtacaaattcgacctgatgttatctgaagacggtagtggtagaggg
gcagctttagtagccgctgtagccgtcaggcaacctaccaggtaa

DBGET integrated database retrieval system