KEGG   Tetranychus urticae (two-spotted spider mite): 107367509Help
Entry
107367509         CDS       T04901                                 

Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00230  Purine metabolism
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107367509
Enzymes [BR:tut01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107367509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N
Motif
Other DBs
NCBI-GeneID: 107367509
NCBI-ProteinID: XP_015790697
LinkDB All DBs
Position
Unknown
AA seq 1056 aa AA seqDB search
MPSNLDKMSPGLIHLTRIHSVRSSDSSGHGFDSLDSSFTDDHIDDRSWSWIYLKSEFTGK
DSEKLFHKYQARLQHNFFMVLLLLNISFNLIAIAIYLWDKQVNTFPGEALMRGSALIVYF
AFLILTCLEEQWLRPRFARIVAALTVLVAMIVSEHGGALFAVTGDKTVYPLQRIRPTFSI
ILTNHVFLPFPSRIYACIGTLVIVSLELLLTIISRAQSDCASTSIIRYAVADTIFYSLGA
FIGFFLTFLLEIANRKAFLDHRSCVESKFKLDYEKEQQDSLLSSCLPRHLMDRVRNDIKL
VIERKERSQRSRQKPFNELYVEKYKNVTILYADIVNSMLLAAKLSPNDLVETLNTLFGRF
DESSERNDCLRIKLLGDCYYCVSGVPEYVENHALNCVRMGLEMIAIIKSVREETQVDVDM
RIGVHSGMVLSGLLGLHKWQYDIFSKDSMIANEMEHTGVPGCVHVTQATLDLIPETERRE
FCIEERKHENGESTYLITPRVLPYNIRTSYGYRNGRQVFKNSVSMDSLTIANLQRTVLVE
SLQKYREMVKYVNDFLADTIDEMPLGKKALWLRQADINPIFLSFTQAFTKRYGTNLFQME
RQFAIQTDPLFRYYLYCSGLICLSMVAIKTIIPNMPISSKLYWTFFVTVVIITGSLTYTF
WTRQQLKYLVRVMIWFVITVWLLLCGTLDMIREDCMKDQKTTSLADCAFTWYYTFCLILA
LTSISLFLRINMWFKLALNLSALLIYITLSRLDCSVISILDSRTKWKYLAYESDLGHIYY
ILTVSIILHVIDRQIEYILRLGFQWTTRLEVERREALVMGEINRILLDNILPQHVAQRFL
YSSFNGAQRYYHEAYDSIAVIFASIPNYAQFYTETNINEEGLKCLLLLNEIICDFDKLLA
DPSFARIEKIKTIGSTYMAASGLHPGRGSTDSDSSLEELNLNVLELVNFGTALMEALARI
NKDALQEFKLRIGISSGPVIAGVVGALKPQYDIWGDTVNVASRMDSYGVIGRINVTESVA
NILMQCSTLELECRGPVLIKGKGEMVTYLVKTPFDS
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgccttctaatctggataaaatgtcgcctggattaatccacctgactaggatacattct
gttcgttcaagtgattcttctggtcatggttttgattcgcttgattcttcctttacagat
gatcacattgatgatcgttcctggtcttggatttatcttaaatcagagtttacgggtaaa
gattctgaaaagctattccacaagtatcaagcccgtcttcagcacaattttttcatggtt
ttacttttactcaacatctcttttaatctgattgcaattgctatttacctctgggataag
caagtgaatacttttcctggtgaagctttaatgcgaggatcggcattaattgtatacttc
gcttttctcatattaacatgtctggaggaacaatggcttcgtccacgattcgctcgcatt
gtggccgcattgacagtacttgtggccatgatagtgtctgaacatggcggtgctcttttc
gctgtaactggcgataaaactgtttacccattgcaacggattcgtccaacattttcaatc
atcttaaccaatcatgtattcctaccctttccatctcgtatttatgcttgcatcggaact
ctggtcattgtttcccttgagctgttactgacaattatatctcgagctcagtcagactgt
gcatcaacatcaatcatccgttatgccgttgctgatacaatattttactcattaggagct
ttcattggtttctttttaacctttttacttgagattgccaaccgtaaagctttcctggac
catcggtcttgcgttgaatcaaaatttaaacttgattacgagaaggaacagcaagattca
cttttatcttcatgtttacctcgccatttaatggatcgtgttcgtaatgatattaaactg
gtcattgaacgtaaagaaagatctcaacggagtcgacaaaagcctttcaatgaactgtat
gtggagaaatacaaaaatgtcacaattctttacgcagacattgtcaattcaatgttactg
gcagccaaattgtcgcccaatgatttagttgaaacgttaaatactctttttggtcgtttt
gatgaatcttcggaaagaaacgactgtcttcgaattaaacttctcggtgattgttattat
tgtgtctctggtgttcccgagtatgttgaaaatcatgccctcaattgtgttcgtatggga
ttggaaatgattgccataatcaaatcagttcgtgaagagactcaggttgatgttgatatg
agaatcggtgttcactctggaatggttttatctggacttttaggtttacacaaatggcaa
tatgatattttttcaaaagactcaatgattgccaatgagatggagcacactggagttcct
ggatgtgttcatgtaactcaagcaacacttgacttgataccagaaacggagagaagagag
ttttgtattgaagaaagaaaacatgagaatggcgaatcaacctatctaattactccgaga
gttttaccttacaatatacgaacttcttatggctatcgaaatggtcgacaagtttttaag
aacagtgtttccatggattctctaaccattgcgaatcttcaaagaacggttcttgttgaa
agtttacaaaaatatcgtgaaatggtgaaatatgtaaacgattttcttgctgataccatc
gatgaaatgcctctcggaaagaaagcactttggcttcgtcaagctgatattaatccaatt
ttcttgagcttcactcaagcctttaccaaacgatacggaaccaatctatttcaaatggaa
agacagtttgccatccaaactgatcctctgtttcgctactacttgtactgttcaggcctg
atttgcctttcaatggtagccatcaaaaccattataccaaatatgccgatatcatctaag
ctatattggactttttttgttactgtagtcattatcactggatcactaacttataccttc
tggacaagacaacaattaaaatatttagttcgtgttatgatttggtttgtcattacagtt
tggcttcttctttgtggcacacttgacatgataagggaagactgtatgaaagatcaaaaa
actacaagtttggcggattgtgcttttacttggtattacacattttgcctgattttagcg
ttaaccagtataagcttatttttgcggattaacatgtggttcaagcttgccctcaacctt
tctgcgttattgatctacatcacattaagccgtttggattgttcagttatatcaattctt
gactctcgtaccaaatggaagtacttagcttatgagtctgatcttggacatatttattac
attttaacggtttccataattcttcatgttattgaccgacaaattgaatacattcttcgt
cttggttttcaatggacaacccgtttagaggtggaacggagagaagccctggtaatgggt
gaaatcaatcggattctgttggacaatattcttcctcaacatgttgctcagcgtttcctt
tattcaagtttcaatggagctcaaagatattaccatgaagcatatgattcaattgctgtt
atttttgcctcaatccctaattatgctcaattttatactgaaaccaatatcaatgaagaa
ggactaaaatgtttacttcttctcaatgaaattatctgtgattttgataagcttctagct
gatccatcatttgctcgaatcgagaaaattaaaaccattggaagtacttatatggcagct
tcaggtttacatcctggacgtggttccacagatagtgattctagtcttgaggagctgaat
ctcaatgttttggaattggtaaactttgggacagctttgatggaagcacttgctcgaata
aataaggatgcattgcaagagtttaaattgcgaatcggtatctcctcaggaccagtgatt
gctggtgtcgttggtgcacttaaaccacaatatgatatatggggggacacagtaaacgtt
gccagtcgaatggactcttatggagtaattggacgaattaatgtaacagagtctgtagct
aatatactgatgcaatgttcaacacttgaattggagtgcagagggccagttctgatcaaa
ggtaaaggtgaaatggttacatatttagttaaaactccttttgattcgtga

DBGET integrated database retrieval system