KEGG   Tetranychus urticae (two-spotted spider mite): 107368753Help
Entry
107368753         CDS       T04901                                 

Definition
(RefSeq) metalloproteinase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Brite
KEGG Orthology (KO) [BR:tut00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tut01002]
    107368753
Peptidases and inhibitors [BR:tut01002]
 Peptidase inhibitors
  Family I35: timp family
   107368753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP NTR
Motif
Other DBs
NCBI-GeneID: 107368753
NCBI-ProteinID: XP_015792114
UniProt: T1KZ34
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MRHITMMGNHQGIPFMMNLIVLIAWSLYFITTSDACSCVYSHPQEHFCSSDFVVTLSIQG
DPKQLHQYNYLRYPVKVYKIYKGMDKTSVRKGFIYTGSALSSCSPTLAKNTTYLMTGRIV
NGKPFVSICNFISEWSSLTYRQKKGFRRNFGRSCGCKVTDAGSYAFYSGYHYNFSNRSID
GQTDNTKGYRRFGYCSWDTKWEIEFDCQGSYSTCLPVPAPSSIYPEPESNDVINFDSNRN
RRNRSKLGQCQWDQNIDYLDCMKRKAERKALLQLEREGEP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagacatattacaatgatgggtaatcatcaaggaatacctttcatgatgaacctaatt
gtattaattgcctggtcactgtattttattaccacttctgatgcctgttcctgtgtctac
tctcatcctcaagagcacttctgttcatctgattttgtggtaactctttcaattcaggga
gatccaaagcaattacatcaatacaattaccttcgttatccagttaaagtttacaaaata
tacaaaggaatggacaaaacctcagttcgcaaaggtttcatctacactggatcagctttg
tcttcttgttcaccgactcttgccaaaaatactacttaccttatgacaggacggattgtt
aacggtaaaccatttgtatcaatctgtaatttcatctcggaatggtccagtttaacttat
cgtcaaaagaaaggatttagacgtaactttggacgctcttgcggctgtaaagtgaccgat
gcaggatcatatgctttttactctggttatcattacaacttcagtaatcgatcgatcgat
ggacaaactgacaacaccaagggttacagacgatttggttactgttcatgggatactaaa
tgggagattgaatttgattgtcaaggttcatattccacttgcttaccagtcccagctcca
agttcaatctaccctgaacctgaatccaatgatgtaataaactttgatagtaatcgcaat
cgacggaatcgatcaaaacttggccaatgtcaatgggatcagaatatcgattatctcgat
tgtatgaaaaggaaagctgaacgtaaagcattacttcaacttgaacgagaaggagaacct
tga

DBGET integrated database retrieval system