KEGG   Tetranychus urticae (two-spotted spider mite): 107369198Help
Entry
107369198         CDS       T04901                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00052  Galactose metabolism
tut00500  Starch and sucrose metabolism
tut01100  Metabolic pathways
tut04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107369198
   00500 Starch and sucrose metabolism
    107369198
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107369198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tut04147]
    107369198
Enzymes [BR:tut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107369198
Exosome [BR:tut04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107369198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107369198
NCBI-ProteinID: XP_015792613
UniProt: T1L0N1
LinkDB All DBs
Position
Unknown
AA seq 877 aa AA seqDB search
MLFISAILFITIFNVESIEVSNNVCSIPSDFRFDCNPDDPSNKETCESRGCCWYPNKDDN
GSPKCFFPTNYQGYVIKGIENRKNGVTVRLTRNSSSGLPQDVSNVNLEVIGLDNERVRIR
FVDADASRFEVPMPFLNVSQSTINSPLYSIKINRDTGNLQVSRQSTGTSIFNVDLSKLIY
ANQFIQLSSLLVNNFLYGLGEHKDTFRKTIDGWKRYTLFAGGTNPTENINLYASYPFYLM
IEPDNQAHGVFLLNSNAMDIITQPAPAITWRTIGGILDFFIFLGPTAPQVIRQNVNLIGR
PVMQPYWSLGFHLCRYDYKSTNKTRETFFRNIQAGIPIETQWNDIDYMDRYNDFTVDPVN
FAGLSDFVNELHSMRLHYVLIMDAGVSGSEPPGSYPPLDDGKKDDIFIKNKSGEIFLGRV
WNFETTAFPDFTNPATLNYWTKQFIDLKNQVDYDGVWIDMNEPYNFHQIMPCPNNSYEYP
PYTPGIQPLNNNTICMSCKQHGGLHYDVHSLFGLLETVATYEAVKNITGIRPFILSRSTF
PSQGHYGSHWSGDIRSTWDFMKYSISNMLEFNIYGIPMIGSDICGFAGNTTEQLCMRWSS
LGAFYPFSRNHNDFDTIEQDPVALGPKVVAATKYAVNLRYRLLPYLYTLFHEAHTKGDTV
ARPIFFEFPLDVNTYSIETSFMWGSGILIVPILEPDTKTVNAYFPEGFWYDFESLKLSVK
STGRYENITIDDDKIGVYARGGSIIPGYLVTAMSIADLSELPGYLFIFLDSSGQASGSWF
SDDGQSIENIQNGEYTYSHCKASLNKISCDYENVFTANNFKIGGIMLVGVDKKPTSVLFN
GTQIDSYFYSDENHALKIDSTEVFERLQSFNVDLSYN
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttattagtgcaattctgtttattacaatctttaatgtagaaagtattgaagtt
tcaaataacgtttgctcaattcctagtgattttaggtttgattgcaacccagatgatcca
agtaacaaggaaacgtgtgagtcaaggggttgctgttggtatcctaataaagatgacaat
ggatcaccaaagtgttttttcccaaccaattatcaaggatatgtgatcaaagggattgaa
aacaggaaaaatggagttacagttagactgacacgcaattccagttctggattacctcag
gatgtttctaatgtgaatttggaagtgattggccttgacaatgaacgagttcggatacga
tttgtcgacgctgatgcttcgagatttgaagtgcccatgccttttctcaatgtatcacag
tcaaccatcaattcacctctatactcaatcaaaataaatagagacactggaaacctccaa
gtctctcgtcaatcaactggaacttcaatcttcaatgttgatctatccaagctaatatat
gccaatcagttcatccaattatcgtcacttcttgtgaacaattttctctatggtttagga
gaacataaagacactttcagaaagactatcgatggttggaaaagatatactttgtttgct
ggtggaaccaatcccactgaaaatatcaatttgtatgcatcatatccattttacttgatg
attgaaccggacaatcaagcgcacggagtattcttgctcaatagcaatgctatggacata
ataactcaaccagctccagcaataacatggagaaccattggtggtatcttagactttttc
atatttcttggaccaacagcacctcaagtcatccgtcaaaatgtcaacttgattggacga
ccagtaatgcagccatactggtctcttggtttccatttgtgtcgatatgattacaaaagt
accaacaaaactcgggaaaccttttttagaaatattcaggctggaatacctattgagact
cagtggaatgacattgactacatggaccggtacaatgatttcactgttgatccagtaaat
tttgctggtttatctgactttgtcaatgagctacattccatgagattacactacgtactg
ataatggatgccggtgttagcggttcagaacctcctggaagctatcctcctcttgatgat
ggcaaaaaagacgatatattcatcaaaaataagtcaggtgaaattttccttggtcgagtt
tggaattttgaaacaactgcattccctgatttcacaaatcctgcaacattaaattattgg
acgaaacaatttattgacttgaagaaccaagttgattatgatggtgtttggatcgacatg
aatgagccctataacttccaccagattatgccatgtcctaataatagttatgaatatcca
ccttatactccaggaattcagcctttaaacaataatactatttgtatgtcttgtaagcaa
catggtggccttcattacgatgttcacagtttgtttggtttactcgaaactgtcgctacc
tacgaggctgttaaaaatataactggaattcgacctttcatattgtctcgttcaacattc
ccatcccagggtcattatggatcacattggtctggtgacattcgatctacatgggatttc
atgaaatattcaatctcaaatatgctggaatttaatatttacggaattcccatgattggt
agtgatatttgtggatttgctgggaacacgactgaacagctgtgtatgagatggtcttca
cttggagctttttatcctttctctcgtaaccacaatgattttgatactattgaacaagat
ccagttgcattaggacccaaagttgtcgctgctaccaagtatgctgtcaatttgcgttat
cgtttgctgccctacctctacaccttgtttcatgaggcacatacaaagggtgataccgta
gctcgacctattttcttcgagttccctttggacgttaatacttattcaatcgaaacatca
ttcatgtggggttctggaattctcattgtcccaatcttagagccagatacgaaaactgtt
aatgcatatttccctgaaggattttggtatgactttgagagtctcaaactatctgtcaaa
agtactggtcgatatgaaaacattacaattgatgatgacaaaattggtgtgtacgctcga
ggtggatcaatcattcctggttacttggtaacagcaatgtctattgctgatttatcagaa
cttccaggctatctcttcatatttcttgactcttcaggtcaagcatctggttcttggttc
tcagatgacggacaatcgattgaaaacattcaaaatggtgaatacacttacagtcattgt
aaagcctctctgaataaaatttcttgcgattatgaaaatgtttttactgctaataacttc
aaaattggtggaatcatgctggttggagttgataaaaagcctacaagtgtgttattcaat
ggaacacaaatagattcgtatttctattcagacgaaaatcacgctctaaaaattgattcc
acagaagtttttgaacgattgcaatcattcaatgttgatttgtcatacaactga

DBGET integrated database retrieval system