KEGG   Tetranychus urticae (two-spotted spider mite): 107372104Help
Entry
107372104         CDS       T04901                                 

Definition
(RefSeq) glycogen [starch] synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
tut00500  Starch and sucrose metabolism
tut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107372104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tut01003]
    107372104
Enzymes [BR:tut01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     107372104
Glycosyltransferases [BR:tut01003]
 Polysaccharide
  Storage polysaccharide
   107372104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 107372104
NCBI-ProteinID: XP_015795741
UniProt: T1JZ80
LinkDB All DBs
Position
Unknown
AA seq 684 aa AA seqDB search
MSSLFRGSSLTNKLSRRFYRIEGLEDQSLDQGAFVDQLNPFCFEIAWEVCNKVGGIYTVI
RSKAPVSVDELGDQYCLIGPYKEHWVKTEVELLEPKESYWKETIDSVAAHGIKLYYGRWL
IDGYPQVILVDIGSAMWKLAEWKHDFWNVCSIGIPNSDIESNDAIIFGYCVAWFMETFYT
KVAAAQDSVPLLVAHFHEWLAGVGLILCRTRHLDISTIFTTHATLLGRYLCAGAVDFYNN
LDKFNLDKEAGDRQIYHRYCIERAAAHSAHVFTTVSEITAIESEHLLKRKPDVVTPNGLN
VKRFHAIHEFQNLHCKAKEKIHEFVRGHFHGHYDFDLDKTLYFFIAGRYEFNNKGADLFI
ESLARLNHELKSQKPDTTVIAFLIFPSRTNNFNVESLKGQAIAKQFRTTVEEVKDDIGSR
LFEIALSGNMPTGDQLLQSADIVKLKRCILSAQRSTLPPICTHNMLEDSTDQVLSAIRRC
KLFNNRSDRVKVIFHPEFLSSTNPLFSMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMG
IPSVTTNLSGFGCFIADHVADPMSYGIYIVDRRFKSPEESVQQLTQQMYDFCALTRRQRI
IQRNRTERLSDLLDWKSLGVYYARSRRLSVSRAHPELLPEDEFEERLQIKYPRPFSEPPS
PRRSRAMTPVASIPGSDDDSSDDN
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgctatttcgtggttccagtttaaccaataaattatctagacgtttctatcga
attgaaggtttagaagatcaaagtcttgatcaaggagcctttgtggatcaactcaatcca
ttttgctttgagatagcatgggaagtgtgcaataaagttggaggtatttatactgttatc
cgaagtaaagctcctgttagtgtggacgagttaggtgatcaatattgtctcattggacct
tacaaggaacattgggttaaaacagaggttgaattgttggaacccaaagaaagctattgg
aaggaaacaatcgatagtgtggccgcacatggaattaaattatattatggtcggtggctg
attgatggttaccctcaagttattttggttgatattggttcagccatgtggaaattagct
gaatggaaacatgatttttggaatgtctgctccattggtatacctaattcagatatagaa
tcaaatgatgccattatttttggctattgtgtcgcctggtttatggaaacattttatact
aaagttgctgcagctcaagacagtgtcccgttactggtggctcattttcacgaatggctg
gccggagttggtctcatcttgtgccgtactcgccatttagatatttcaacaatttttact
acccatgcaaccctcttaggtcgatatttatgtgctggagcagttgatttttataataat
cttgataagttcaatttggataaagaagccggagacagacaaatttatcatagatactgt
attgaaagagcagcagcacattcagcacatgttttcacaacagtctctgaaattactgca
attgagtcggaacatttactcaaacgtaaacctgacgttgttactccaaatggtcttaat
gttaaaaggtttcatgcaatccacgagtttcaaaatctccattgtaaagctaaagaaaag
attcacgaatttgtgcgaggtcatttccatggtcattatgatttcgatctagataaaact
ctttattttttcatcgctggtcgatatgagtttaataataaaggagctgatctttttatt
gaaagtttagcccgtctcaatcacgagcttaaatcacaaaagccggacacaactgtaata
gcctttttaatcttcccatctcgtactaataatttcaatgtggagtctttgaaaggtcaa
gcaattgctaagcaatttaggactaccgtagaagaggttaaagatgatattggttctcga
ttatttgaaattgctttaagtggaaacatgccaacgggtgatcaactcctccaatcagcg
gacattgttaaacttaaaagatgcatcctttctgcgcaaaggtcaacactgccaccaata
tgtactcataacatgcttgaagactcaactgatcaggttttatctgccatacgtcgatgt
aaattgttcaacaatcgttcggatcgtgttaaagtcatcttccatccagaatttttatcc
tccaccaatcctcttttcagtatggattatgaagagtttgttcgtggatgccatttagga
gttttcccatcctattatgaaccatggggctatacaccagcggaatgtactgttatggga
atacctagtgttactaccaacctttcaggttttggatgtttcattgccgatcatgttgca
gatccaatgtcttatggtatttatattgttgatcggcgattcaaaagcccagaggaatct
gttcaacaattgactcaacaaatgtacgacttttgcgcgttaacaaggcgtcagcgaatt
atacaaagaaatcgaactgaaagattaagtgacttattagattggaaaagccttggtgtg
tattatgcacgctctcggcgactttcagtttcccgtgcccatcctgagcttcttccagaa
gacgaattcgaggaaagactgcaaatcaaatatcctagacctttcagtgaaccaccttca
cctcgtcgatctcgtgcaatgactcctgttgcctcaatccctggcagtgatgatgatagc
tctgatgacaattag

DBGET integrated database retrieval system