KEGG   Trichomonas vaginalis: TVAG_010780
Entry
TVAG_010780       CDS       T01022                                 

Definition
(RefSeq) glycosyl hydrolase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00513  Various types of N-glycan biosynthesis
tva00520  Amino sugar and nucleotide sugar metabolism
tva00531  Glycosaminoglycan degradation
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TVAG_010780
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    TVAG_010780
   00531 Glycosaminoglycan degradation
    TVAG_010780
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    TVAG_010780
   00604 Glycosphingolipid biosynthesis - ganglio series
    TVAG_010780
   00511 Other glycan degradation
    TVAG_010780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tva03110]
    TVAG_010780
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TVAG_010780
Chaperones and folding catalysts [BR:tva03110]
 Intramolecular chaperones
  Others
   TVAG_010780
SSDB
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b F5_F8_type_C Glycohydro_20b2 Metallothi_Euk2 DUF5730
Other DBs
NCBI-GeneID: 4775875
NCBI-ProteinID: XP_001329989
UniProt: A2DP05
LinkDB
AA seq 766 aa
MFSYLILSTSSHYGRPPEILNLKRKINCAEFDSETARCTKCEENYFINPYGVCEKQKAST
EKSTVNYDTQEIFSNPVHHHHDCDHEHGKHSNDIPDSQLPIIPYPNSVKLYPGNFTIQAS
TRVYTNLQGDDKALFLNYIYLEELPVSSTPFELEKNVIKLLLDDTLDMNDEAYNLLVTQD
AITIKAKTTKGIFYGIQTILQLYQKYDDEGEIPCCEIYDSPAFEYRGVMLDVSRHFVPLE
FIYKQIDMLAHFKINTLHIHLTDTGGWRIEIKQYPLLTQKAAYRNESDWNRWCNSGLDGH
YNDTGTPGAYGGFYTQDQMRELVSYATKKFINIVPEIEMPGHSEEVMYAYPEYSCAGQPY
VNHDLCVGNPDTFTFLCNVLTEVMDIFPSPYIHIGGDEALKYGWKTCPKCLKVMQDNNFT
DFDQLQSYLIKKIEAFLDEHNRHLLGWDEILEGGLPPHAYVMSWTGEQGGIIAAQTGHHV
VMSPSLYMYLDHYQDEFFAQPDARLPPRTLENIYNYYPVPDVLTPEEAKLILGVQGNVWT
EFITSPSHVEYMMYPRAMAVSEIGWTQKNNKNYNLFMDRLHHEIQNLIAKGYFPHRTDNL
YLNRQQSLVPKKHLALNKKVTYTAPYNPNYPAAGDGALVDGQLGGWNFDDGTWQGFYYRN
DIEFQFDLTIDLEEITNIHKVAVNFMRQSEQARIYWPQRFVVSLSSDNVNWNTVLDETYD
YVNTIYGLSLKKYTGDGVSAQYVRVQAKMFDDLQDQWLFVDEVVVE
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgttttcttatcttatcctttcgacttcttcccattacggaagaccaccagagattttg
aacctcaagagaaagattaactgcgcagagtttgactccgaaacagctcgttgcactaaa
tgcgaagaaaattattttattaatccatatggcgtttgcgaaaagcaaaaagcaagtaca
gaaaagagtactgttaattatgatacacaagaaatcttttcaaacccagttcatcatcac
catgattgtgaccatgagcatggaaagcatagtaatgatattcctgactcgcaattacca
attattccatatcctaacagcgtcaagctctatcctggcaactttactattcaagcttca
acaagagtttatacaaatttgcagggtgacgataaggcattgttcctaaattacatttac
cttgaagaactcccagtatcatccaccccgttcgaattagagaaaaacgtcatcaaatta
cttcttgatgatacattagacatgaacgatgaagcctacaatctccttgttacacaagat
gccataaccatcaaagctaagaccacaaaaggcatcttttacggtatacaaaccattctc
caattatatcagaaatatgacgacgaaggagagatcccatgctgcgaaatctatgatagt
ccagcatttgaatacagaggcgtcatgcttgatgtctcacgccacttcgtaccacttgaa
tttatttacaaacaaattgatatgctagcacacttcaagatcaacactctgcatatccat
ttaacagatacaggtggctggcgtatcgaaatcaagcaatatccattacttacccagaaa
gccgcatatcgaaacgaatctgattggaacagatggtgcaattccggacttgacggacat
tacaatgacacaggaacaccaggagcatatggtggcttctatacacaggaccaaatgaga
gaattagtttcttatgcaactaaaaagttcataaacattgttccagagattgaaatgccc
ggacattcagaagaagtcatgtacgcgtacccagaatactcatgtgctggccagccatac
gtaaatcatgacctttgtgttggaaatcctgacacttttacatttttatgcaatgttttg
acagaagtcatggacattttcccatctccttatatccacattggaggcgatgaagctctt
aaatacggatggaagacatgtcctaaatgtctaaaagtcatgcaggacaacaatttcact
gatttcgatcaattacaatcctatttaatcaaaaagattgaagcttttttggacgaacac
aacagacatttacttggctgggatgagatcttagaaggaggattgccaccacatgcttac
gtcatgtcatggactggcgaacaaggaggaatcattgccgcacaaacaggtcatcatgtt
gttatgtcaccttctttgtatatgtatttagatcattaccaagatgaattctttgcacag
cctgatgcgagattaccaccaagaacacttgaaaacatctataactattaccctgtacct
gatgttttgactcctgaagaagcaaaactcattttaggtgtacaaggaaatgtttggaca
gaattcatcacttcaccttctcatgttgaatatatgatgtatccaagagcaatggctgtt
agtgagataggctggacacaaaagaataataagaactacaacttgtttatggatagattg
catcatgaaatacagaatttgattgctaaaggttatttcccacatagaactgataatttg
tatttgaacagacaacaatcattagttcctaagaaacacttggctttgaacaagaaagtt
acttacacagctccttataatcctaattatccagctgctggagatggtgctttggtcgat
ggacaacttggtggttggaatttcgatgatggaacatggcaaggattttattatagaaat
gatatagagttccaattcgatttaactattgatttggaagaaattacaaatatccataaa
gttgctgttaacttcatgagacagtctgaacaggcaagaatatactggccacagagattc
gttgtttctttgtcttctgataatgttaactggaatacagttttggatgaaacttatgat
tacgttaacacaatttatggattgtctttgaagaaatacacaggtgatggagtttctgct
caatacgttcgcgtccaggctaagatgttcgatgacttacaagaccaatggctattcgtc
gatgaggtcgttgttgagtaa

KEGG   Trichomonas vaginalis: TVAG_451400
Entry
TVAG_451400       CDS       T01022                                 

Definition
(RefSeq) glycosyl hydrolase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00513  Various types of N-glycan biosynthesis
tva00520  Amino sugar and nucleotide sugar metabolism
tva00531  Glycosaminoglycan degradation
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TVAG_451400
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    TVAG_451400
   00531 Glycosaminoglycan degradation
    TVAG_451400
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    TVAG_451400
   00604 Glycosphingolipid biosynthesis - ganglio series
    TVAG_451400
   00511 Other glycan degradation
    TVAG_451400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tva03110]
    TVAG_451400
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TVAG_451400
Chaperones and folding catalysts [BR:tva03110]
 Intramolecular chaperones
  Others
   TVAG_451400
SSDB
Motif
Pfam: Glyco_hydro_20 ECSCR SKG6 Insulin_TMD CD99L2 EphA2_TM
Other DBs
NCBI-GeneID: 4754880
NCBI-ProteinID: XP_001310032
UniProt: A2FDA0
LinkDB
AA seq 401 aa
MSILLESLQLHNAMYNNSFITRNAFMLDVARRKMTKDQILQAINSINITCFRYLMLHLSD
DQSYSLGFITDTLKIGKQTIGNGWLTDSDLAEIVSLAKSKSLYLIPDIDAPSHVGSWYKS
YQSSGESTDIFSDSNTLDIEKLDSSSGVYEIYKKCMTIFKDVSNYINIGVDEVPGNTYYA
NQLASHINKINQIAKENNYKTVVWNDALNGKLLQQLDSDITIMYWHDSDVNTFEALLNTK
NPIKNAYYDTNYDNVHDLDEPEYQKGKITKFVNNLINNNILCLWGEDSEDITHDQIINFI
NDVQNEMIKNNKIIPIEKREESKSDDGNGTYNGNKTDGSLITPTISPIPDDSSKKGLTNQ
EKGMIAGIVIAVVAIAAIVVGIFLFRKKCQQEDSAEEIQNI
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgtcaatcttacttgaatctttacaattgcataatgcaatgtataacaatagcttcata
acgcgtaatgcattcatgctagacgttgcaagacgcaaaatgacaaaagatcagatctta
caggctatcaattcaataaatattacgtgtttcagatatttaatgctacacctttcagat
gatcaatcatattcacttggttttattacagacacattaaaaattgggaagcaaacaatt
ggaaacggttggctgactgactccgatctcgcagaaatagtaagtttagccaaatcaaaa
tcactttatctcattcctgatattgatgctccttcacatgttggatcatggtacaaaagc
tatcaatcttctggagaatcaactgatatatttagtgattccaatactttagacatagag
aaattagattcatctagcggagtctatgaaatttacaaaaaatgtatgaccatcttcaag
gatgtttcaaactatattaatattggtgttgatgaagttcctggtaatacttattatgct
aaccaacttgcttctcacataaacaaaattaatcaaattgctaaagaaaacaactacaaa
actgttgtttggaacgatgcattgaatggcaaattgctacagcaactagactctgacatt
acaattatgtattggcatgattctgatgttaatacatttgaggcattattaaatacaaaa
aatccgatcaaaaacgcttactatgatactaactatgacaacgttcatgatcttgacgaa
cctgaataccagaaaggaaaaattacaaaatttgttaataatttaattaataataacatt
ttatgcctttggggagaagattcagaagatattacgcatgatcagattattaattttatt
aacgatgttcaaaatgaaatgataaaaaataataaaataattccaatagaaaaaagagaa
gaaagcaagtcagatgatggaaatggtacatataatggaaataaaactgatggttcgcta
ataactccaacaatttcacctatcccagatgattcttcaaagaaaggccttacaaatcag
gagaaaggcatgattgctggtatagtgatcgctgttgtagcaattgcagcaatagttgtc
ggaatttttttattccgcaaaaaatgccaacaagaagactcagcagaagaaattcaaaac
atttag

KEGG   Trichomonas vaginalis: TVAG_484030
Entry
TVAG_484030       CDS       T01022                                 

Definition
(RefSeq) glycosyl hydrolase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00513  Various types of N-glycan biosynthesis
tva00520  Amino sugar and nucleotide sugar metabolism
tva00531  Glycosaminoglycan degradation
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TVAG_484030
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    TVAG_484030
   00531 Glycosaminoglycan degradation
    TVAG_484030
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    TVAG_484030
   00604 Glycosphingolipid biosynthesis - ganglio series
    TVAG_484030
   00511 Other glycan degradation
    TVAG_484030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tva03110]
    TVAG_484030
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TVAG_484030
Chaperones and folding catalysts [BR:tva03110]
 Intramolecular chaperones
  Others
   TVAG_484030
SSDB
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Other DBs
NCBI-GeneID: 4768426
NCBI-ProteinID: XP_001322715
UniProt: A2EA46
LinkDB
AA seq 550 aa
MRRARISLDIRDCIIPIIYGVIITLIIIKFVLSNPAIDPTSIIPHPYSVSFSAKIELFDL
TSSSVVCYDNTKPKLKTQAQFLVGYIFEQAGISVNLIGKISDDCSIIIDTGYQDSNEEAY
NLTITDYKIYINGSTSRGSFYGIQTLRKLIPTQKVYSVKFYQVEIIDRPRFSFRGLLLDV
SRYFQTFDNVKRFIDIMALHNMNYFHFHITDDQGWRFQSKKYPNLTLIGSMRNSTMKDGI
PRGGFYTQDELRKLVQYAADRQITIVPEIDLPGHSVSALAAYPDLGCTGGPYHVAQKFGP
QIDILCVGNPNTMTFIKDILTEVMEIFPSEYVHIGGDEVNKFHWRNCKKCQSRIRKLNLW
DDENSKEEYMQAYFTQELANFLASKGKKAIGWSEAAYVGKIGNLTVLSWLRHSAKGKSET
FGYPTILAPTKPFYLDYRQEFVDDSTYVIKGAPVNTLRDVYTYEPIEKFHKDEDIKNILG
IEACVWGEMTPNFERVMYQTLPRAAATAVAQWSEPVTKNYNSFVGSLNALTKIYDVNNWT
YFKKFRQVEY
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgagaagggcaagaatttcgcttgacattagagattgcataataccgatcatatatggt
gttattattactctaattataattaaatttgtcttatcaaacccagcaatcgatcctaca
tctattattccgcatccttattcagtatctttctctgcaaaaatagaattattcgatttg
acatcatcatcagtagtttgttatgacaatacaaaacctaaacttaaaactcaagctcaa
tttcttgttggttacattttcgaacaagcaggcatttctgtcaatctaattggaaaaata
tcggatgactgctctataataattgatactggttatcaagactccaatgaagaagcttat
aaccttacaattactgattataaaatttatattaacggaagtacaagcagaggatcattt
tatggcattcaaacgctaagaaaattgattccaactcaaaaagtatacagtgtcaaattc
tatcaagttgaaatcatcgatagaccgagattttctttcagaggacttcttttagatgtc
tcacgctatttccaaacattcgataatgtcaagagattcatagatatcatggctctccac
aatatgaactatttccattttcatatcacagatgaccaaggctggcgctttcaatcaaag
aaataccccaatcttacgcttattggctccatgaggaactccacaatgaaagatggaatt
cctcgcggtggattttacacacaagatgaactccgcaaacttgttcaatacgcagcagac
cgccagatcacaattgtaccagaaatcgacttaccaggccattccgtctctgctttggcc
gcctatcccgaccttggatgcacaggcggaccttatcatgttgcacaaaaatttggtcca
caaattgacattctttgtgtcggaaatccaaatacaatgacatttataaaggatattctc
acagaagttatggaaatcttcccttcagagtacgtccatatcggtggagatgaagtaaac
aaattccattggagaaattgtaaaaagtgtcaaagtcgtatacgaaaacttaatttgtgg
gatgatgagaacagcaaagaagaatacatgcaagcatatttcacccaggagctcgcaaac
ttcttagcatccaaaggaaagaaggcaatcgggtggtctgaagctgcttatgttggaaaa
attggaaatttgacggttttgagttggttgaggcattcagcgaaaggaaaatcagaaaca
ttcggatacccaacgattttggcaccaacaaaaccattctatcttgactacagacaggaa
ttcgtcgatgactccacttatgtcataaaaggagcacctgtaaacacattaagagatgtt
tacacttatgaaccaattgaaaaattccacaaagatgaagatataaagaatatccttggt
atagaggcttgtgtatggggagaaatgactccaaactttgagagggtcatgtaccaaaca
ttgccaagagctgctgccactgctgttgctcaatggagtgaacctgtaacaaagaattat
aactcttttgttggatctttgaatgctttaacaaagatttatgatgtcaacaattggact
tatttcaagaaatttagacaagtggagtattaa

DBGET integrated database retrieval system