KEGG   Trichomonas vaginalis: TVAG_023510
Entry
TVAG_023510       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K08515  vesicle-associated membrane protein 7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_023510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_023510
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_023510
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    TVAG_023510
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_023510
SSDB
Motif
Pfam: Longin
Other DBs
NCBI-GeneID: 4754424
NCBI-ProteinID: XP_001309581
UniProt: A2FEM2
LinkDB
AA seq 210 aa
MEFCYASILRKDIPLVQHCPEQGNFDLFFQRYVENNKLEPGKTILLADNFLWGILYEEEG
LTYICVVKNTNDRNILDKALDDMKSRFIRSHGTDWRKASPFGLQTSFEPQLILVKQSLLS
VAGAIVPPSQIDEADEGVSPLVDEEYPSEFESAAENSLIVRIPKMIKPSIAKQEITHIFV
WILVFLLCAFIIYFILVLICGGFDLSPRCL
NT seq 633 nt   +upstreamnt  +downstreamnt
atggaattttgttatgcttctatacttaggaaagatattcctttagttcagcactgtcca
gaacaagggaatttcgatctctttttccaacgttatgttgaaaacaacaaacttgaacca
ggaaaaacaattctcttagcagacaattttttatggggaatactatatgaggaagaagga
ctcacttatatatgcgttgttaaaaatacaaatgatagaaatattttagataaagccctt
gatgatatgaaaagtagatttattcgtagtcatggtacagattggagaaaagcaagtccg
tttggcctccaaactagctttgagccacaacttatcttggttaaacaatcattactttca
gttgcaggcgcaattgtcccgccttcgcaaattgatgaagctgatgaaggagtttctcct
ttagttgatgaagagtatccatcagagtttgaaagtgcagctgaaaactcattaattgtt
agaattccaaaaatgattaagcctagcatagcaaagcaagaaattacgcacatatttgtt
tggatacttgtgtttttgctttgcgcatttattatttacttcattctcgttcttatttgc
ggcggatttgatttatcacctcgttgtttataa

KEGG   Trichomonas vaginalis: TVAG_037080
Entry
TVAG_037080       CDS       T01022                                 

Definition
(RefSeq) Synaptobrevin family protein
  KO
K08515  vesicle-associated membrane protein 7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_037080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_037080
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_037080
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    TVAG_037080
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_037080
SSDB
Motif
Pfam: Synaptobrevin Longin Laminin_II Pex24p
Other DBs
NCBI-GeneID: 4753538
NCBI-ProteinID: XP_001308705
UniProt: A2FH50
LinkDB
AA seq 215 aa
MISYTAVARGQTIIATYSPDGTDLNREAQKLLETPLEKNEQRRMNRFIFTFLKKNSLVFI
CASSADDPSSIPLQYLDKLSDRWYLSFYEASKRAGPNGLSTQTADLFRAVLDDISTSNNK
AEKIKREMEQTTRIMTDSMQKAISRGEDLENLSNKTEDLLSTSVDFKNQATNLKNKMRCA
RYKSLAFWGIILLVIIYYILTKICGGYNLKPRCLK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgatttcatatacagctgttgcacgtggccagacaatcattgctacatactcaccagat
ggaacagatttaaatagagaagctcagaagcttttggagactccacttgaaaaaaatgaa
caaagaaggatgaatcgttttattttcacatttctcaagaaaaattcacttgttttcata
tgtgcttctagtgcagatgatccatcatctataccactgcaatatttggataaattgtct
gatagatggtatttaagtttctacgaagcatcaaagagagccggaccaaatggcctttct
actcaaacagccgacttattcagagcagtcttggacgatatttcaacaagtaataataag
gcagagaaaattaagagagaaatggaacaaacaacaagaatcatgactgattcgatgcaa
aaagctatttctagaggagaagatctggaaaatctctccaataaaacagaagatctttta
tctacatctgtagactttaagaaccaagcgacaaacctgaaaaataagatgagatgcgcg
cgatacaaatcccttgctttctggggcattattttacttgtaattatttattacatttta
acaaagatttgtggtggttataacttaaagccacgttgcttaaaataa

KEGG   Trichomonas vaginalis: TVAG_037100
Entry
TVAG_037100       CDS       T01022                                 

Definition
(RefSeq) Synaptobrevin family protein
  KO
K08515  vesicle-associated membrane protein 7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_037100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_037100
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_037100
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    TVAG_037100
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_037100
SSDB
Motif
Pfam: Synaptobrevin Longin Ferlin_C Beta_lactamase3 Fzo_mitofusin CbiG_mid Cnl2_NKP2
Other DBs
NCBI-GeneID: 4753540
NCBI-ProteinID: XP_001308707
UniProt: A2FH52
LinkDB
AA seq 215 aa
MSFLYGAVAYQNTIIAELSNASGNMSQIVPGILKQVKFDDKNVSFEQQQYLFSLISRSNK
ITVLILTTKDVKGNVRFYAVDQIYQKFVMKYPNYASLGPLSKSGEFGPTIQEIFTQLNNP
QQQKIAEINRNIQATQEIMTQNLADALVRGEKLEVMQEKSEALQQHASAFERSAKKVEQK
MCWERYRWYILGGAVAAAVIIIIIIIIATTAGKKK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtctttcttatacggtgctgttgcataccaaaacacaatcattgcagaactctctaat
gcctcaggtaacatgagccaaattgttcctggcattcttaaacaagtcaagtttgatgac
aagaatgtttctttcgaacagcagcagtatctcttctccctcatctctcgttccaacaag
attacagttcttatcctcacaaccaaggatgttaagggcaacgttcgtttctacgctgtt
gatcagatctatcaaaagtttgtcatgaagtatccaaactacgcctcactcggcccactc
tccaagtcaggcgagttcggaccaacaatccaggagatctttacacagttaaacaaccca
cagcaacagaagattgccgaaatcaacagaaacatccaagccacacaggaaatcatgaca
cagaaccttgccgatgctctcgtacgtggtgagaagctcgaagtcatgcaggaaaagtca
gaagcccttcaacaacacgcatcagccttcgaaagatcagcaaagaaggtcgaacagaag
atgtgctgggagagatatcgctggtacatcctcggtggtgctgttgctgcagctgtcatc
atcataattattattatcatcgcaactacagcaggaaagaagaaatga

KEGG   Trichomonas vaginalis: TVAG_091610
Entry
TVAG_091610       CDS       T01022                                 

Definition
(RefSeq) Synaptobrevin family protein
  KO
K08515  vesicle-associated membrane protein 7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_091610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_091610
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_091610
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    TVAG_091610
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_091610
SSDB
Motif
Pfam: Synaptobrevin Longin Sec2p
Other DBs
NCBI-GeneID: 4747648
NCBI-ProteinID: XP_001302901
UniProt: A2FYP9
LinkDB
AA seq 215 aa
MIPYTTVARGQTIIASYSRDGTDLSREVQKLLEQPYVVNEQRRMNRYIFTFCKKNNLTFI
CASPAESPTSYAVQYLDRLSDCWCLTLLDASKTATQNSLSNSTKDIFDAVYKDVIENEPS
SEKIKREMEQTQRLMTESVQLAMSRGNDLENLSTKTEDLLSTSADFRNNAVNLKNKMLCA
RYKAYALYTAIVFIILYYILAKICGGYSLKPRCRK
NT seq 648 nt   +upstreamnt  +downstreamnt
atgattccttatacaactgtagccagaggacagacaataattgcttcatactcacgcgat
ggtactgatttatcccgcgaagttcaaaagttgctagagcagccttatgttgttaacgaa
caaagaagaatgaacagatatatttttacattctgtaaaaagaacaatttaacatttatt
tgcgcatcacctgccgaatcaccaacaagctatgctgtccaatacttggatagactttct
gattgttggtgtctgactttattagatgcttctaagacagcaacgcaaaattcattatca
aattcaacaaaagatatatttgacgctgtttacaaggatgttatcgaaaatgaaccaagt
tcagaaaaaataaagcgagaaatggaacaaactcagcgactaatgaccgaatcagtacaa
ttagctatgagtagaggtaatgatctcgagaatttgtcaacaaaaaccgaagatttactt
tccacttcagcagatttcagaaacaacgccgtaaatcttaaaaacaagatgctttgtgca
aggtataaggcttatgccttatacactgctattgtttttataattctttactatatctta
gcaaaaatttgcggaggttactcattaaagcccagatgccgcaaatga

KEGG   Trichomonas vaginalis: TVAG_206570
Entry
TVAG_206570       CDS       T01022                                 

Definition
(RefSeq) Synaptobrevin family protein
  KO
K08515  vesicle-associated membrane protein 7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_206570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_206570
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_206570
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    TVAG_206570
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_206570
SSDB
Motif
Pfam: Synaptobrevin Longin LMBR1 DUF5345 Prominin WBP-1 DUF1910 ABC2_membrane_3
Other DBs
NCBI-GeneID: 4746649
NCBI-ProteinID: XP_001301908
UniProt: A2G1I4
LinkDB
AA seq 220 aa
MTILYAAVVKDRTMIASLVVDKADFEKEVLKLLPQASAKTEQVISSNYIFSFLSLSSLIF
VCVTPQTEDRRVPLNYLDAISHRWGPTIGGSTVTPTSHIYDKQFQEAFGEFTRSFANPAY
KTKAIQQTLEQTQAELTDAMTKAYSRGNQLEDLDDKSQQLLSNSEDFKQASTQLKNQMRC
KYYKELLFWFLVIFIVFYFLLALICGGMNLKPRCIKEKSN
NT seq 663 nt   +upstreamnt  +downstreamnt
atgacaattctttatgcagctgttgttaaggacagaacaatgattgcatctttagttgtt
gataaggctgacttcgaaaaggaggttcttaagctcttacctcaagcatctgcaaaaaca
gaacaagttatctcatcaaattacatattttcatttctttctctttcatctttaatattt
gtatgcgtaacacctcaaacagaagacagaagagtccctcttaattatttagatgctatt
tctcaccgttggggtccaacaatcggtggatcgactgtaactcctacaagtcatatatac
gataagcaattccaagaagcattcggcgaatttacaagatcttttgctaatccagcatac
aagacaaaagctattcaacaaacgttagaacaaacacaagcagagttaacagatgcaatg
acgaaagcatacagccgtggaaatcagctcgaagaccttgatgataaatcccagcagtta
ttatcaaatagtgaagatttcaagcaggcatcaactcagttaaagaatcaaatgcgttgc
aaatactacaaggagcttttattctggttccttgtaatcttcattgtattttatttcctt
cttgcattaatttgcggcggaatgaatttgaagccacgctgcataaaggaaaagagtaac
taa

KEGG   Trichomonas vaginalis: TVAG_360030
Entry
TVAG_360030       CDS       T01022                                 

Definition
(RefSeq) hypothetical protein
  KO
K08515  vesicle-associated membrane protein 7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_360030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_360030
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_360030
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    TVAG_360030
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_360030
SSDB
Motif
Pfam: DUF2207 Longin RIFIN Synaptobrevin DUF5383 BSMAP DUF4452
Other DBs
NCBI-GeneID: 4774403
NCBI-ProteinID: XP_001328617
UniProt: A2DTC2
LinkDB
AA seq 204 aa
MEIEYLAITRNNIILAQSASGDGDFDIAINEILISKDLSNERMRVDKLGYRFFILHNKKE
LNVIAACDVDAQADQAFRILESIQKTVLTSYANKWEVSSSFDLQSDFEPQLRNTILAHSK
TLQIQPTEIDDSDQILANLGKSIESDHKNAQNENTFTEVSEAHNSPSYTRLKLKLFVSKY
RWIFLSIIILFILLIILIIMFITP
NT seq 615 nt   +upstreamnt  +downstreamnt
atggaaatagaatatcttgcaattactcgaaataatattatcctagcacaaagtgctagt
ggtgatggtgatttcgatatagcaattaatgaaatcctgatatcaaaagatctctcaaac
gaaagaatgagagtggacaagttgggatatcgatttttcattcttcataataaaaaagaa
ttgaatgttattgctgcttgtgatgtggatgctcaagcagatcaagcatttcgtatttta
gaaagcattcaaaaaacagtcttaacatcttatgcaaacaaatgggaagtttcatcatcg
tttgacctacagagtgattttgaaccacaactaagaaacacaattcttgcgcattcaaag
actttacaaattcagccaacagaaatcgatgattctgaccaaatactggctaatttggga
aagtcaattgaatcagatcataaaaacgcacagaatgaaaatacatttactgaagtctct
gaagctcataattccccatcatacacacgtctaaagcttaaattattcgtttctaagtac
agatggatcttcttatcaataattatccttttcattcttttgatcattttaattatcatg
tttattacgccataa

KEGG   Trichomonas vaginalis: TVAG_395670
Entry
TVAG_395670       CDS       T01022                                 

Definition
(RefSeq) Synaptobrevin family protein
  KO
K08515  vesicle-associated membrane protein 7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_395670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_395670
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_395670
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    TVAG_395670
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_395670
SSDB
Motif
Pfam: Synaptobrevin TSKS GP41 tRNA-synt_2
Other DBs
NCBI-GeneID: 4748207
NCBI-ProteinID: XP_001303451
UniProt: A2FX43
LinkDB
AA seq 231 aa
MKCCFAGIYRGSIPLVTHSTEDGMWDRIFLNMCENGKVKQGIQLLNTNGYLMGILRDVDD
LSFMIVTKDIDDKTAEDHLQRLKSEFIRANLNWRTAEQLSLMSVYEGKLTDFMTRVTRQA
KVSKIETNVSGTMDEMKEQYYELFQRQCNLEHINQLAEELDSHSGLYENNAVKLKRKLCW
ERYRWYVIGGSITLIVFLIIIIVSCGGFNLQPRCIKPAATPAPTTPPVDPA
NT seq 696 nt   +upstreamnt  +downstreamnt
atgaagtgttgcttcgcaggcatatatagagggagcattcctcttgtaactcactcaaca
gaagacggaatgtgggatagaatattcctcaatatgtgtgaaaacggaaaagttaagcag
ggcattcaattattgaatacaaatggatatttgatgggaatattacgagatgttgatgat
ttgtcattcatgattgttacaaaagatattgatgacaaaacagctgaagaccatcttcag
cgtctaaaaagcgaatttattagagcaaatttaaactggcgtactgcagaacaactctca
ttgatgagtgtttacgaaggcaagctaacagactttatgactcgcgtcacaagacaagca
aaagtaagtaagattgaaacaaacgtttccggcacaatggatgagatgaaagagcagtat
tacgaactgttccagcgccagtgcaatcttgagcatataaaccaattggctgaagaatta
gatagccattctggtctctacgaaaataatgcagttaaactcaaacgtaaattgtgctgg
gaaagatatcgctggtacgtaattggtggaagtattactcttatcgtatttttgataatt
attattgtttcatgcggcggatttaacttacaaccacgctgcattaaaccagcggctaca
ccagcaccaactactcctccagttgatcctgcataa

KEGG   Trichomonas vaginalis: TVAG_449870
Entry
TVAG_449870       CDS       T01022                                 

Definition
(RefSeq) Synaptobrevin family protein
  KO
K08515  vesicle-associated membrane protein 7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_449870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_449870
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_449870
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    TVAG_449870
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_449870
SSDB
Motif
Pfam: Synaptobrevin Longin Prominin RIFIN Ferlin_C Glyco_transf_15 Orf78
Other DBs
NCBI-GeneID: 4758070
NCBI-ProteinID: XP_001313180
UniProt: A2F4D1
LinkDB
AA seq 240 aa
MSNSNNNINYAAVCRGNTILAQAAITSGNFDSAIVDIIGKMDPNQSQVMTEKGQYRYFVI
HDQQGLNFIAAGATSVQAKLAFEFLENVQKRFNLQYARMWRIVPAYGMQQEFGSQIQSLI
TSTNNDKIRTIKSNIAATQETMTEAMQNALLRGDKIETMNEKAEVMAANAKEYERSATRV
KRKMCWERYRWYLIGIVCVIVLILIIVLIACKGFKCSHSSTTPTPTPIPPTPTTTPNLQP
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtcgaacagcaataacaatattaactatgcagcagtctgccgcggcaatacaatttta
gcccaggcagccattacaagtggcaactttgattctgcaattgttgatataattggtaaa
atggatccaaaccaatctcaagttatgacagaaaagggccaataccgctattttgttatc
catgatcagcaaggacttaacttcattgctgctggtgcaacatccgttcaggctaagctc
gctttcgaattccttgagaacgttcaaaagagatttaaccttcaatatgctcgtatgtgg
agaatagttccagcttacggcatgcaacaggagttcggatcccaaatccaatcccttatt
acttcaactaacaatgataaaatccgcacaatcaaatctaacatcgcagcaacacaggaa
acaatgacagaagccatgcaaaatgctctccttcgtggtgacaagattgaaacaatgaat
gaaaaggcagaagtcatggcagctaacgctaaggaatacgaaagatcagctacacgtgta
aagaggaagatgtgctgggagagatatcgttggtatcttatcggcattgtttgcgtcatt
gttctcattttgatcattgtacttattgcatgcaagggattcaagtgcagccactcatca
acaacaccaacaccaactccaatcccacctactccaactacaacaccaaatcttcagcca
taa

KEGG   Trichomonas vaginalis: TVAG_476920
Entry
TVAG_476920       CDS       T01022                                 

Definition
(RefSeq) Synaptobrevin family protein
  KO
K08515  vesicle-associated membrane protein 7
Organism
tva  Trichomonas vaginalis
Pathway
tva04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:tva00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    TVAG_476920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_476920
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tva04147]
    TVAG_476920
Membrane trafficking [BR:tva04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    TVAG_476920
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVAG_476920
SSDB
Motif
Pfam: Synaptobrevin Longin T4SS_pilin
Other DBs
NCBI-GeneID: 5468321
NCBI-ProteinID: XP_001583749
UniProt: A2DAB5
LinkDB
AA seq 233 aa
MSYEFAAVLRDNTMLALYAIGSGNHDVVTQEILKGIDPGEKNITCERGQKRYYVLHEVTG
LNFIVGTDNYVSSNDAFTFLQNLERKFILQYAKQWKTAHIYQMQQEFSPQIKNMIDSKAL
IKIEQIKENLEETQVFMNHTFEQALLRESKLSELEDRSTRLANGASEFERNAGRIRRRMW
FEHYKYYIVGFCIIAGAIFLAIIAVCGGFSFSECKSKPKPTPTPSISPTPLPK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagctatgaatttgctgccgttcttcgtgataacaccatgcttgcactttatgcaatt
ggaagtggtaatcacgatgtagttacacaagaaattttgaaaggaattgatcctggagaa
aaaaatatcacttgtgaaagagggcaaaagcgatattatgtactccatgaagtcactgga
ttaaattttatcgttggaactgacaattatgtttcgtctaatgacgcttttacattttta
cagaatttagaacgaaaatttatccttcagtacgcaaagcaatggaaaactgcgcatatt
tatcaaatgcaacaagaattttctccgcaaatcaaaaatatgatcgattctaaagcatta
ataaaaattgaacagattaaagaaaatttagaagaaactcaagttttcatgaatcatact
tttgaacaggcattactacgtgaatcaaaactcagtgaattagaagatcgctcaactaga
ttagcaaatggtgcttctgagtttgaaagaaatgctggaagaatcagaagaagaatgtgg
ttcgaacattacaagtattatattgttggattttgcattattgctggagcaatttttctc
gcaataatcgctgtgtgtggtggctttagttttagcgaatgcaaatctaaacctaagcct
acacctacaccatcaatatctccaacacctttaccaaaataa

DBGET integrated database retrieval system