KEGG   Trichomonas vaginalis: TVAG_030610
Entry
TVAG_030610       CDS       T01022                                 

Definition
(RefSeq) glycosyl hydrolase
  KO
K01191  alpha-mannosidase [EC:3.2.1.24]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:tva00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_030610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tva04131]
    TVAG_030610
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.24  alpha-mannosidase
     TVAG_030610
Membrane trafficking [BR:tva04131]
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Selective cargos
    TVAG_030610
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyco_hydro38C2
Other DBs
NCBI-GeneID: 4760225
NCBI-ProteinID: XP_001330648
UniProt: A2EY99
LinkDB
AA seq 1233 aa
MLNSLFLLSIKKVYDKKFQLKKVSKYIHLIAAAKDVNFIFAEDSYFTPNATADFIPPSQL
NYTWIPMKASEDFKFNETKKNWFAFKGNVKIPKEYSPHRDILRLTFDVAAHYNVRRWDDE
FPAGPEGQIWLNGKHVGAIDEFHNSHIITEGGLVEIRLYTGRCSSSHVLNKFGITISNRW
AEKLYYYLKVTEKLLKDIPENNTQRDQIIDILNEVLPMIDIREITWPIVLPIVRYHDRDL
SNFFGSLPNALDKLMKLLKTLPQHTEDDPFINVIGYSHLDSVWEWPFNISHYKFRNTVSS
MIHLFENPPTDEIPKWRFLATSPLHYKWLEKDDPILFEKLMEYAKKDRIEVDGLTFVEMD
TNLPSGEALVRQVLYGVKYFEGKLGFKQSTLFLPDCFGFSPSIPQILKNAGIENFVTSKI
SWNEYNSFPHHTFIWKGIDGSQIYSHFITTPSSWSYQAFTYTGLCNMREIVGTYSCYNEK
FINGVALHTAGNGDGGGGLTEEMLYNMEVLNKLPKIEGVPHLKFNKLSEIFEKIKKYQEK
LPLWDGELYLEYHRGTATTQELVKKQNKMLEQTLHNVEWLLSIYKSLFWQNNVTFYKEAI
EELWEETMMLQFHDSLPGTCINEANNDIVMKGQNTLRKLNKLQKNLTEKLTEKMKVSTEE
NTKILFNTLPFVRKLNGITVPSGGWTFTTTEFPYIDYKVDMYEILESSSEYKKNEFNFSF
IEPKNDIKVSSTDNETFSVLTDELNVTFSKINGSILQIRSLKTKRPFLRGPSNMFEFYED
RSIHWPAWDIQLFHKEMPLKAPKFLNYSIENNSIQLSYIICDEPECNIENENCHGYKNTR
YLKRKSKTEAKNETKIEKVSEINGTDSKNVTELNESITENNTENKVNDEKINKNITEIIE
DNEDKNNKEIKEKSDENNKEIKEKSDENNKEIKEKSDKDDKDNDKKNETEHSGESCEDKP
DEENDSFKVTIINQTIYFREKGVIDFVTFVDWHEHDKLLKILYQTNIRSKSAKYGTQFGH
HERPTHGNLPQDMAMFEVNGKWADYSDSTGGIYITSDSKYGNDIHEGDLRMSLLKAPLQT
DMWADYGRREFTYRMMFHDKEENIEFQRQNLDLVTDFVIANYEQPNTTLSLDDLPMEAQF
VNITGNVILDTLKLSEDEKGIVVRVFEANGGWTECSLSFPLLNRKNWKIVPCNLLEKEVK
YEFNVDESKSYLSFSFEIETFKILSFKLERVEE
NT seq 3702 nt   +upstreamnt  +downstreamnt
atgctaaattctctctttttgctgtcaatcaagaaagtatatgataagaaattccaactc
aagaaggtttcaaagtacatacacttgatagcagctgccaaagacgtgaatttcattttt
gctgaagattcatattttacgcccaatgcaactgccgactttattccgccatcgcaattg
aattacacttggataccaatgaaagcttcggaagatttcaaatttaatgaaactaaaaag
aattggttcgcatttaaaggaaatgttaaaattccaaaagaatattcaccacatagagat
attttacgtcttacatttgatgtggctgcacattacaatgtccgtcgctgggatgatgaa
ttccctgccggaccagaaggacaaatttggttaaatggaaaacatgtaggcgcaattgat
gaatttcataattctcatattattacagaaggagggttagttgaaattcgtctttataca
ggcagatgcagttcaagtcacgttttaaataaatttggaattacaatttcaaacagatgg
gccgaaaaactatactattatctaaaggttacagaaaagttattgaaagacataccagaa
aacaatacacagcgcgaccaaataatagatatcttaaatgaagttttgccaatgatagac
atcagagaaataacatggccgattgtattaccaattgtacgatatcatgatcgtgatttg
agcaatttcttcggttctcttccaaatgctttagataaactcatgaaattacttaaaaca
ttgcctcagcatacagaagacgatccatttattaatgttattggctactcacaccttgat
tcagtctgggaatggccatttaacatttctcattacaaattccgaaatacagtgtcatca
atgatccatttattcgaaaatccaccaacagacgagatacccaagtggagattcctcgct
acatcgccattacattataaatggctcgaaaaagatgatccaattttatttgagaagttg
atggaatacgcaaagaaggatagaatagaagtagatggtctaacatttgtagaaatggac
acgaatttaccaagcggagaagctttggtaagacaagttttatatggcgtcaaatacttc
gaaggaaagcttggattcaagcaatcaacacttttcctacctgattgtttcggtttttca
ccgtcaattcctcaaattttgaagaacgccggaattgaaaatttcgtaacttcaaaaatt
tcatggaatgagtacaacagcttcccacaccatacattcatatggaaaggaatcgatggc
tcccaaatttactcccatttcatcacaactccaagcagctggtcgtaccaagcattcact
tacaccggattatgtaacatgagggaaattgttggaacatactcttgttacaacgaaaaa
ttcatcaatggtgttgcattgcatactgctggaaatggtgatggcggtggaggactcact
gaagagatgctttacaacatggaagtcctaaacaaacttccgaaaattgaaggagttcct
cacttaaaattcaataaactctcagaaatttttgagaagatcaaaaaataccaagaaaaa
ttaccactttgggatggggaattatatctagaatatcatagaggaacagcaacaacacaa
gaacttgtcaagaaacagaacaaaatgttagaacaaactttacataatgttgaatggttg
ttatcaatttataagtcacttttctggcaaaataatgtcactttttataaagaagcgata
gaagaattatgggaagaaacaatgatgttacaattccatgacagtttgccaggaacatgc
atcaatgaggcaaataatgatattgttatgaaaggccaaaacacactaagaaaattaaac
aaattacaaaagaatttgacagaaaaattgacagaaaagatgaaagtttccacagaagaa
aacacaaaaattttgttcaatactttgccatttgtaagaaaattgaatggaataacagtt
ccttctggcggttggacatttacaactacagaatttccatatattgactacaaagtagac
atgtatgagattcttgaatccagctctgaatacaagaagaatgaattcaatttctctttc
attgagcctaaaaatgacataaaagtttcttcaactgacaatgaaacattttctgttttg
actgacgagttgaatgttacattttctaagattaatggttctatattacagataaggagt
ttgaagacaaaaagaccatttttacgtggtccttccaatatgtttgaattttatgaagac
agatccattcattggccagcgtgggatatacagttattccacaaagaaatgcctttgaaa
gctccgaaattcttgaactattcaattgaaaacaactcaatccaactgagttacatcatt
tgcgatgaacctgaatgcaacatcgaaaacgaaaactgccatggatacaagaacacaaga
tatctaaagagaaaatctaaaacagaagctaaaaacgaaactaaaattgaaaaagtttca
gaaattaatggaactgattctaaaaatgttacagaacttaatgaatctattacagaaaac
aatacagaaaataaagttaatgatgagaaaattaataaaaatattactgaaattatcgaa
gacaatgaagataaaaataataaagaaattaaagaaaaaagtgacgaaaataataaagaa
attaaagaaaaaagtgacgaaaataataaagaaattaaagaaaaaagtgacaaagacgat
aaagataatgataagaagaatgagacagaacattcaggagagagttgtgaagataaacca
gatgaagaaaatgactctttcaaggttacaattatcaatcaaacaatttatttcagagaa
aaaggtgtcattgattttgtcacttttgttgattggcatgaacacgataaacttcttaag
atattatatcaaacaaacatcagatccaagagtgccaaatacggcacacaattcggtcat
cacgaaagaccaacgcatggaaatttgccacaagacatggcgatgtttgaagtcaatgga
aaatgggctgattattcagattccacaggaggaatctatataacatctgattctaaatat
ggaaacgatatccacgaaggtgacttgagaatgagtttgttgaaagcaccacttcaaact
gatatgtgggcagattacggaagaagagaattcacttacagaatgatgttccatgataaa
gaagaaaatattgagttccagagacagaatctggatcttgtaacagattttgttatagct
aactatgaacagccaaatacaacattgagtttggacgatttgccaatggaggcacaattt
gtgaatattacaggaaatgtcattttagatacccttaaattgagtgaggacgaaaaagga
attgttgtcagagtcttcgaagcgaatggtggatggacagagtgcagtttatcattcccg
ttgttgaacagaaagaattggaagattgttccttgcaatttgcttgaaaaagaagttaaa
tacgaatttaatgtagacgaaagcaagtcttatctttctttctctttcgaaatagaaaca
tttaagatattatctttcaaacttgaacgtgttgaggaataa

DBGET integrated database retrieval system